Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507ADK6

Protein Details
Accession A0A507ADK6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKNKKSQQIKFKVRCQTHHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVGDIKKFIEICRRKDASSARIKKNKKSQQIKFKVRCQTHLYTLVLKDSEKAEKLKQSLPPNLTITDVSKKEKKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.55
7 0.53
8 0.57
9 0.6
10 0.6
11 0.67
12 0.71
13 0.73
14 0.77
15 0.77
16 0.77
17 0.78
18 0.77
19 0.79
20 0.86
21 0.88
22 0.84
23 0.83
24 0.81
25 0.72
26 0.68
27 0.62
28 0.55
29 0.48
30 0.46
31 0.4
32 0.33
33 0.32
34 0.29
35 0.23
36 0.2
37 0.17
38 0.14
39 0.16
40 0.16
41 0.18
42 0.2
43 0.25
44 0.28
45 0.32
46 0.37
47 0.41
48 0.47
49 0.47
50 0.48
51 0.45
52 0.43
53 0.4
54 0.34
55 0.31
56 0.31
57 0.33
58 0.34
59 0.39
60 0.45