Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507B2W9

Protein Details
Accession A0A507B2W9    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
100-121ITSTRSCRPKKHHESEPPETKHBasic
137-162PESKHHKSEEPKTKHHHKSEAPTPAPBasic
NLS Segment(s)
PositionSequence
128-128K
140-144KHHKS
147-148PK
Subcellular Location(s) extr 9, pero 5, golg 4, mito 3, cyto 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKIFLSTSLLALLSAWVCAAEDILPVPTSCNAYFRFRKCYTETVTALPTCIRHCPMIPDMVCPQMVKLKTKHVPCHTPTITKSAPCPPCPTGCVIPTSTITSTRSCRPKKHHESEPPETKHHKSEEPKTKHHESEAPESKHHKSEEPKTKHHHKSEAPTPAPTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.05
6 0.06
7 0.05
8 0.05
9 0.06
10 0.07
11 0.08
12 0.08
13 0.09
14 0.1
15 0.14
16 0.14
17 0.17
18 0.19
19 0.26
20 0.34
21 0.37
22 0.44
23 0.43
24 0.48
25 0.48
26 0.52
27 0.5
28 0.5
29 0.48
30 0.42
31 0.43
32 0.38
33 0.34
34 0.28
35 0.23
36 0.17
37 0.18
38 0.17
39 0.15
40 0.16
41 0.2
42 0.2
43 0.26
44 0.25
45 0.25
46 0.24
47 0.25
48 0.24
49 0.2
50 0.19
51 0.17
52 0.18
53 0.19
54 0.19
55 0.26
56 0.31
57 0.37
58 0.44
59 0.44
60 0.49
61 0.48
62 0.56
63 0.49
64 0.47
65 0.43
66 0.42
67 0.38
68 0.31
69 0.32
70 0.31
71 0.33
72 0.3
73 0.34
74 0.29
75 0.29
76 0.29
77 0.31
78 0.25
79 0.22
80 0.23
81 0.19
82 0.19
83 0.18
84 0.2
85 0.17
86 0.16
87 0.17
88 0.17
89 0.2
90 0.25
91 0.34
92 0.36
93 0.43
94 0.49
95 0.59
96 0.67
97 0.72
98 0.75
99 0.76
100 0.81
101 0.83
102 0.84
103 0.77
104 0.72
105 0.69
106 0.62
107 0.57
108 0.52
109 0.51
110 0.48
111 0.55
112 0.6
113 0.62
114 0.67
115 0.69
116 0.72
117 0.66
118 0.62
119 0.58
120 0.52
121 0.56
122 0.58
123 0.54
124 0.51
125 0.54
126 0.53
127 0.53
128 0.5
129 0.46
130 0.45
131 0.53
132 0.59
133 0.61
134 0.66
135 0.7
136 0.78
137 0.81
138 0.8
139 0.79
140 0.76
141 0.78
142 0.79
143 0.81
144 0.73
145 0.67