Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AQE5

Protein Details
Accession A0A507AQE5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
143-191GATPGSAKKRVKKEKEPKEKDPKEKEPKEESPRKRKTPAKKEPAAKVEIBasic
NLS Segment(s)
PositionSequence
137-186PKRKAAGATPGSAKKRVKKEKEPKEKDPKEKEPKEESPRKRKTPAKKEPA
Subcellular Location(s) cyto 6, cyto_mito 6, mito 6, nucl 14
Family & Domain DBs
Amino Acid Sequences MSPATPDHSKTPEKGDKAKVIDKADKGEKNPTAENIKGKKNPHDFTINELLLGTALLLSLKGGEIIIDPERLAFHGGYANANSARANSHNVLRKFRGLMNPSGDPAAGEAGDKDSAGTAAAGAAGDTPAKATPVSTPKRKAAGATPGSAKKRVKKEKEPKEKDPKEKEPKEESPRKRKTPAKKEPAAKVEIVIEEGTGDEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.6
4 0.62
5 0.65
6 0.62
7 0.6
8 0.61
9 0.56
10 0.56
11 0.56
12 0.54
13 0.51
14 0.54
15 0.51
16 0.48
17 0.48
18 0.46
19 0.43
20 0.42
21 0.48
22 0.45
23 0.5
24 0.51
25 0.53
26 0.58
27 0.61
28 0.59
29 0.55
30 0.56
31 0.48
32 0.49
33 0.54
34 0.44
35 0.34
36 0.32
37 0.27
38 0.2
39 0.19
40 0.12
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.06
53 0.07
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.1
60 0.07
61 0.06
62 0.08
63 0.09
64 0.1
65 0.1
66 0.11
67 0.1
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.12
74 0.12
75 0.17
76 0.24
77 0.27
78 0.3
79 0.31
80 0.31
81 0.3
82 0.31
83 0.33
84 0.28
85 0.29
86 0.29
87 0.27
88 0.26
89 0.25
90 0.21
91 0.15
92 0.12
93 0.09
94 0.05
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.1
120 0.19
121 0.26
122 0.32
123 0.37
124 0.41
125 0.45
126 0.45
127 0.42
128 0.39
129 0.42
130 0.38
131 0.36
132 0.38
133 0.41
134 0.43
135 0.47
136 0.46
137 0.44
138 0.52
139 0.6
140 0.64
141 0.69
142 0.77
143 0.82
144 0.89
145 0.9
146 0.89
147 0.9
148 0.9
149 0.89
150 0.88
151 0.88
152 0.88
153 0.86
154 0.84
155 0.81
156 0.81
157 0.82
158 0.82
159 0.82
160 0.82
161 0.85
162 0.84
163 0.85
164 0.84
165 0.85
166 0.86
167 0.87
168 0.86
169 0.85
170 0.86
171 0.86
172 0.83
173 0.76
174 0.65
175 0.56
176 0.48
177 0.4
178 0.33
179 0.24
180 0.17
181 0.13