Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507AY27

Protein Details
Accession A0A507AY27    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-82SGDNTKKKREKAKAVRERVKKEABasic
NLS Segment(s)
PositionSequence
65-112KKKREKAKAVRERVKKEAAEKEKAEKEKAEKEKAEKEKAEREKAERER
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MADDKGDPSRWSHSTGEAQEFQERIAATQSTRSSAYSGTVEEIGIGISINPIDASLAISSGDNTKKKREKAKAVRERVKKEAAEKEKAEKEKAEKEKAEKEKAEREKAERERENERTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.42
4 0.39
5 0.39
6 0.38
7 0.36
8 0.31
9 0.27
10 0.23
11 0.17
12 0.17
13 0.15
14 0.12
15 0.18
16 0.18
17 0.18
18 0.19
19 0.19
20 0.17
21 0.16
22 0.18
23 0.13
24 0.13
25 0.12
26 0.11
27 0.1
28 0.09
29 0.09
30 0.06
31 0.05
32 0.05
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.03
43 0.04
44 0.04
45 0.04
46 0.05
47 0.08
48 0.12
49 0.14
50 0.16
51 0.25
52 0.31
53 0.37
54 0.47
55 0.52
56 0.6
57 0.67
58 0.77
59 0.79
60 0.83
61 0.86
62 0.85
63 0.82
64 0.76
65 0.72
66 0.63
67 0.59
68 0.59
69 0.56
70 0.54
71 0.51
72 0.53
73 0.54
74 0.55
75 0.51
76 0.45
77 0.45
78 0.48
79 0.54
80 0.54
81 0.51
82 0.54
83 0.61
84 0.65
85 0.66
86 0.62
87 0.6
88 0.63
89 0.67
90 0.7
91 0.65
92 0.63
93 0.66
94 0.69
95 0.73
96 0.7
97 0.66
98 0.66