Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507BKK7

Protein Details
Accession A0A507BKK7   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
61-90ADSKSKKKASAAKKSRRKYRQLKDGQDAEQHydrophilic
NLS Segment(s)
PositionSequence
64-80KSKKKASAAKKSRRKYR
Subcellular Location(s) cyto_nucl 4, mito 20, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPAVQNKTNSAVQLTHIPTGIVVKSQATRSRSQNRKIARDLLAAKLDEMENGEHSRTAIVADSKSKKKASAAKKSRRKYRQLKDGQDAEQQPQAQLSPNDQMRSKEDSVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.23
4 0.22
5 0.19
6 0.21
7 0.19
8 0.12
9 0.1
10 0.11
11 0.13
12 0.18
13 0.24
14 0.25
15 0.3
16 0.37
17 0.48
18 0.54
19 0.58
20 0.61
21 0.62
22 0.65
23 0.65
24 0.62
25 0.54
26 0.52
27 0.47
28 0.43
29 0.38
30 0.31
31 0.27
32 0.22
33 0.19
34 0.13
35 0.12
36 0.09
37 0.08
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.13
49 0.18
50 0.22
51 0.26
52 0.26
53 0.26
54 0.31
55 0.39
56 0.43
57 0.49
58 0.57
59 0.64
60 0.73
61 0.81
62 0.86
63 0.86
64 0.87
65 0.86
66 0.86
67 0.86
68 0.86
69 0.86
70 0.84
71 0.8
72 0.73
73 0.7
74 0.61
75 0.53
76 0.47
77 0.39
78 0.31
79 0.26
80 0.24
81 0.21
82 0.2
83 0.21
84 0.25
85 0.29
86 0.32
87 0.34
88 0.36
89 0.36
90 0.42