Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507B9Y3

Protein Details
Accession A0A507B9Y3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MFKKIRKSFRRVRARLRALLHHydrophilic
NLS Segment(s)
PositionSequence
4-17KIRKSFRRVRARLR
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFKKIRKSFRRVRARLRALLHRQPPPATTTPPPVEPPPLGHHTPPPAEPPPLGPPPPPPAEPSPDAFADMTPPPGTPLPPYVSEADSSDGLPIYLTDDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.78
4 0.78
5 0.75
6 0.76
7 0.72
8 0.67
9 0.63
10 0.57
11 0.52
12 0.48
13 0.43
14 0.38
15 0.34
16 0.36
17 0.35
18 0.35
19 0.37
20 0.32
21 0.32
22 0.28
23 0.28
24 0.26
25 0.28
26 0.28
27 0.26
28 0.27
29 0.27
30 0.28
31 0.25
32 0.25
33 0.22
34 0.21
35 0.2
36 0.2
37 0.22
38 0.23
39 0.23
40 0.19
41 0.21
42 0.24
43 0.27
44 0.25
45 0.24
46 0.23
47 0.27
48 0.29
49 0.28
50 0.25
51 0.23
52 0.23
53 0.2
54 0.17
55 0.15
56 0.14
57 0.14
58 0.12
59 0.11
60 0.13
61 0.13
62 0.14
63 0.13
64 0.17
65 0.18
66 0.19
67 0.22
68 0.22
69 0.22
70 0.23
71 0.22
72 0.21
73 0.18
74 0.17
75 0.15
76 0.13
77 0.11
78 0.1
79 0.09
80 0.09