Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AP18

Protein Details
Accession A0A507AP18   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
8-36AYAHRLQDFCRIRRKKKQGLKITAKLTKDHydrophilic
NLS Segment(s)
PositionSequence
20-24RRKKK
Subcellular Location(s) cyto_nucl 10.5, mito 7, nucl 17.5
Family & Domain DBs
Amino Acid Sequences MHCLNVMAYAHRLQDFCRIRRKKKQGLKITAKLTKDLLPTQSAPFNFKKEESILPGISDDEISILREKAAASRIGIADFRVGGGGALHHSHTYSHYHHTTTGPHSYNHHQRRPMPSALSARRGGSLCLNPVDPSALPMGRTSPNVGLGLGMDLGLSHHHQQQQQQQLDGGSDYSSPVSSTTKICRCGGVAASERSVSPQGSFLGLEKEMSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.39
4 0.47
5 0.54
6 0.62
7 0.73
8 0.82
9 0.82
10 0.84
11 0.89
12 0.89
13 0.9
14 0.91
15 0.88
16 0.86
17 0.82
18 0.73
19 0.65
20 0.56
21 0.49
22 0.43
23 0.39
24 0.32
25 0.3
26 0.3
27 0.31
28 0.33
29 0.3
30 0.31
31 0.31
32 0.32
33 0.3
34 0.29
35 0.29
36 0.28
37 0.3
38 0.3
39 0.31
40 0.27
41 0.26
42 0.25
43 0.22
44 0.19
45 0.16
46 0.1
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.07
53 0.08
54 0.08
55 0.1
56 0.12
57 0.12
58 0.11
59 0.14
60 0.14
61 0.14
62 0.14
63 0.13
64 0.11
65 0.09
66 0.09
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.08
79 0.12
80 0.13
81 0.17
82 0.18
83 0.19
84 0.21
85 0.21
86 0.23
87 0.22
88 0.26
89 0.23
90 0.22
91 0.25
92 0.29
93 0.38
94 0.43
95 0.45
96 0.43
97 0.46
98 0.53
99 0.55
100 0.51
101 0.43
102 0.4
103 0.43
104 0.42
105 0.42
106 0.36
107 0.31
108 0.31
109 0.29
110 0.25
111 0.21
112 0.2
113 0.17
114 0.16
115 0.16
116 0.14
117 0.14
118 0.15
119 0.11
120 0.1
121 0.11
122 0.1
123 0.1
124 0.1
125 0.13
126 0.13
127 0.14
128 0.15
129 0.14
130 0.15
131 0.15
132 0.15
133 0.12
134 0.1
135 0.1
136 0.08
137 0.06
138 0.04
139 0.03
140 0.04
141 0.05
142 0.07
143 0.09
144 0.13
145 0.17
146 0.2
147 0.26
148 0.34
149 0.42
150 0.43
151 0.42
152 0.39
153 0.35
154 0.34
155 0.29
156 0.21
157 0.12
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.09
164 0.11
165 0.12
166 0.16
167 0.24
168 0.29
169 0.34
170 0.34
171 0.34
172 0.34
173 0.35
174 0.34
175 0.32
176 0.32
177 0.3
178 0.31
179 0.3
180 0.29
181 0.28
182 0.28
183 0.22
184 0.17
185 0.17
186 0.16
187 0.17
188 0.17
189 0.15
190 0.18
191 0.17