Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553HWS6

Protein Details
Accession A0A553HWS6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
256-275SDAWGRMKRKSEKYMNELNLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
CDD cd05374  17beta-HSD-like_SDR_c  
Amino Acid Sequences MSIPVWLITGSSNGLGLVLTLHVLRAGHRVVASVRSKAKSADAVKKIEEAGGSVIEMDMTESQESIARKVKAIGRIDFLINNAGYSILAACEVISEKEATLQLNTNFFGPLYTMQAALPAMRAQGSGTIVNVSSVAAQDPLPACSLYSASKAALEAASESLALEVAPHGINVLIVEPGNFRTNFVSALSDASPNPESIPEHYDNPVGQIVRKFLTVHGKQIGNPEEGVARIFEAVTGKGGPAGHLAGKVRRLVLGSDAWGRMKRKSEKYMNELNLQEESAKSTDYQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.07
10 0.07
11 0.08
12 0.12
13 0.13
14 0.14
15 0.14
16 0.16
17 0.17
18 0.25
19 0.27
20 0.29
21 0.34
22 0.34
23 0.35
24 0.35
25 0.36
26 0.37
27 0.41
28 0.45
29 0.44
30 0.46
31 0.46
32 0.46
33 0.43
34 0.36
35 0.28
36 0.19
37 0.15
38 0.12
39 0.11
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.11
51 0.12
52 0.14
53 0.2
54 0.19
55 0.2
56 0.25
57 0.29
58 0.33
59 0.38
60 0.36
61 0.33
62 0.34
63 0.35
64 0.31
65 0.27
66 0.23
67 0.18
68 0.15
69 0.12
70 0.1
71 0.08
72 0.08
73 0.07
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.08
85 0.09
86 0.09
87 0.09
88 0.13
89 0.13
90 0.15
91 0.15
92 0.14
93 0.13
94 0.12
95 0.11
96 0.09
97 0.08
98 0.09
99 0.1
100 0.09
101 0.09
102 0.1
103 0.1
104 0.09
105 0.09
106 0.06
107 0.06
108 0.05
109 0.06
110 0.05
111 0.06
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.07
127 0.07
128 0.08
129 0.08
130 0.07
131 0.07
132 0.08
133 0.07
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.07
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.07
165 0.1
166 0.1
167 0.1
168 0.11
169 0.12
170 0.13
171 0.13
172 0.12
173 0.1
174 0.12
175 0.12
176 0.12
177 0.11
178 0.14
179 0.13
180 0.12
181 0.12
182 0.12
183 0.12
184 0.13
185 0.2
186 0.19
187 0.2
188 0.21
189 0.22
190 0.21
191 0.22
192 0.22
193 0.17
194 0.17
195 0.17
196 0.18
197 0.17
198 0.18
199 0.17
200 0.17
201 0.27
202 0.26
203 0.3
204 0.33
205 0.33
206 0.34
207 0.41
208 0.41
209 0.32
210 0.3
211 0.26
212 0.21
213 0.2
214 0.19
215 0.12
216 0.09
217 0.07
218 0.07
219 0.07
220 0.08
221 0.08
222 0.09
223 0.09
224 0.09
225 0.11
226 0.11
227 0.1
228 0.11
229 0.12
230 0.12
231 0.14
232 0.17
233 0.19
234 0.22
235 0.24
236 0.23
237 0.23
238 0.23
239 0.21
240 0.22
241 0.2
242 0.2
243 0.22
244 0.24
245 0.25
246 0.3
247 0.31
248 0.32
249 0.4
250 0.46
251 0.51
252 0.59
253 0.66
254 0.7
255 0.76
256 0.81
257 0.76
258 0.74
259 0.66
260 0.58
261 0.49
262 0.41
263 0.35
264 0.25
265 0.24
266 0.17
267 0.17