Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553IBY2

Protein Details
Accession A0A553IBY2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-80GEPAPKRGRGRPPKQTKTPLYBasic
NLS Segment(s)
PositionSequence
61-73EPAPKRGRGRPPK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAPNSQPRRSPRINATSNNESQPSLSANHGGSASKETTGEDQHATTDDTPQPNIPLRPAGEPAPKRGRGRPPKQTKTPLYSQVVARQLHNTTDQRSLPQQDAPSGQASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.68
4 0.66
5 0.61
6 0.53
7 0.43
8 0.36
9 0.3
10 0.24
11 0.18
12 0.16
13 0.16
14 0.14
15 0.15
16 0.15
17 0.14
18 0.13
19 0.15
20 0.14
21 0.12
22 0.12
23 0.11
24 0.13
25 0.14
26 0.15
27 0.12
28 0.12
29 0.12
30 0.12
31 0.13
32 0.11
33 0.13
34 0.14
35 0.15
36 0.15
37 0.15
38 0.16
39 0.17
40 0.17
41 0.14
42 0.14
43 0.14
44 0.15
45 0.16
46 0.18
47 0.23
48 0.24
49 0.3
50 0.35
51 0.39
52 0.41
53 0.46
54 0.53
55 0.56
56 0.64
57 0.68
58 0.72
59 0.75
60 0.81
61 0.84
62 0.8
63 0.75
64 0.73
65 0.7
66 0.63
67 0.58
68 0.52
69 0.49
70 0.49
71 0.44
72 0.39
73 0.35
74 0.31
75 0.3
76 0.35
77 0.31
78 0.28
79 0.33
80 0.33
81 0.33
82 0.38
83 0.4
84 0.35
85 0.37
86 0.36
87 0.34
88 0.35
89 0.34