Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553HUJ8

Protein Details
Accession A0A553HUJ8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-77VPQKRYARVAAKRRHKKFEEBasic
NLS Segment(s)
PositionSequence
67-74AAKRRHKK
Subcellular Location(s) cyto 10.5, cyto_nucl 13, mito 2, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13606  Ank_3  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MQGQDITQMLLDMNVGIAARSKNGSSPLHIAALASNIEVILSFLNKGADIEAVNYDQVPQKRYARVAAKRRHKKFEEILPEAASQNRGVGRRMQSDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.07
5 0.07
6 0.08
7 0.1
8 0.1
9 0.12
10 0.17
11 0.18
12 0.19
13 0.23
14 0.23
15 0.23
16 0.22
17 0.2
18 0.15
19 0.15
20 0.12
21 0.08
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.03
28 0.03
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.1
44 0.12
45 0.13
46 0.17
47 0.2
48 0.23
49 0.25
50 0.31
51 0.37
52 0.44
53 0.52
54 0.57
55 0.65
56 0.73
57 0.78
58 0.81
59 0.75
60 0.75
61 0.72
62 0.72
63 0.71
64 0.65
65 0.61
66 0.54
67 0.51
68 0.44
69 0.38
70 0.3
71 0.2
72 0.18
73 0.2
74 0.19
75 0.2
76 0.26
77 0.31