Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553HM90

Protein Details
Accession A0A553HM90    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
208-235EDSAEKKRAKRTRPGKKHRIILRVREKABasic
247-284TLEKEQHLQEKRKRLNRERKLKRRQKEREKKAGAQGTNBasic
NLS Segment(s)
PositionSequence
213-279KKRAKRTRPGKKHRIILRVREKAARDREEAAKKSTLEKEQHLQEKRKRLNRERKLKRRQKEREKKAG
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MAHTTFLTLGNPSDVRFRVRRKDLDDSASASTSSGEEEVGHDAEAELALRAKLNAQLSGLLDFSFKVDPKAQQHQTGQLKDQLQGQAPDVTSEVQQEDENPEEEAFTFRLFRDEALTHTVVLTNDEDPAALGDGGFVVPLRPRSYYIASSPSPGKVSEYRSVAVSAEYVLADAKRRRWGLEKPWRVIRITPNSNSVSPKTIPGSAQEEDSAEKKRAKRTRPGKKHRIILRVREKAARDREEAAKKSTLEKEQHLQEKRKRLNRERKLKRRQKEREKKAGAQGTNPDGGRADDSLRKDAEDEASVAGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.34
4 0.42
5 0.48
6 0.56
7 0.63
8 0.64
9 0.72
10 0.71
11 0.69
12 0.64
13 0.57
14 0.52
15 0.45
16 0.37
17 0.28
18 0.22
19 0.16
20 0.14
21 0.11
22 0.08
23 0.07
24 0.09
25 0.11
26 0.11
27 0.11
28 0.1
29 0.09
30 0.09
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.12
40 0.13
41 0.14
42 0.14
43 0.16
44 0.16
45 0.17
46 0.16
47 0.12
48 0.11
49 0.1
50 0.11
51 0.12
52 0.11
53 0.13
54 0.16
55 0.21
56 0.28
57 0.37
58 0.39
59 0.43
60 0.45
61 0.52
62 0.56
63 0.53
64 0.5
65 0.46
66 0.43
67 0.38
68 0.41
69 0.34
70 0.29
71 0.27
72 0.26
73 0.23
74 0.22
75 0.21
76 0.17
77 0.15
78 0.13
79 0.13
80 0.12
81 0.09
82 0.09
83 0.1
84 0.12
85 0.12
86 0.13
87 0.12
88 0.12
89 0.11
90 0.11
91 0.12
92 0.1
93 0.09
94 0.09
95 0.08
96 0.1
97 0.1
98 0.1
99 0.13
100 0.13
101 0.14
102 0.18
103 0.18
104 0.16
105 0.16
106 0.17
107 0.13
108 0.14
109 0.13
110 0.09
111 0.09
112 0.08
113 0.08
114 0.06
115 0.07
116 0.06
117 0.04
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.06
127 0.08
128 0.09
129 0.11
130 0.14
131 0.17
132 0.19
133 0.2
134 0.23
135 0.22
136 0.23
137 0.23
138 0.2
139 0.18
140 0.16
141 0.17
142 0.15
143 0.2
144 0.22
145 0.23
146 0.22
147 0.22
148 0.22
149 0.19
150 0.16
151 0.12
152 0.08
153 0.06
154 0.06
155 0.05
156 0.05
157 0.05
158 0.09
159 0.11
160 0.14
161 0.19
162 0.2
163 0.22
164 0.27
165 0.33
166 0.4
167 0.5
168 0.54
169 0.53
170 0.59
171 0.59
172 0.55
173 0.51
174 0.49
175 0.48
176 0.46
177 0.44
178 0.42
179 0.43
180 0.44
181 0.43
182 0.36
183 0.3
184 0.25
185 0.26
186 0.22
187 0.21
188 0.2
189 0.21
190 0.24
191 0.2
192 0.21
193 0.19
194 0.17
195 0.17
196 0.19
197 0.19
198 0.17
199 0.22
200 0.25
201 0.34
202 0.41
203 0.47
204 0.55
205 0.63
206 0.71
207 0.77
208 0.84
209 0.86
210 0.86
211 0.88
212 0.86
213 0.85
214 0.81
215 0.8
216 0.8
217 0.77
218 0.72
219 0.69
220 0.64
221 0.63
222 0.64
223 0.58
224 0.51
225 0.47
226 0.53
227 0.56
228 0.56
229 0.51
230 0.46
231 0.42
232 0.45
233 0.47
234 0.46
235 0.41
236 0.43
237 0.46
238 0.49
239 0.57
240 0.59
241 0.63
242 0.63
243 0.69
244 0.74
245 0.76
246 0.79
247 0.81
248 0.84
249 0.85
250 0.89
251 0.9
252 0.91
253 0.94
254 0.94
255 0.93
256 0.93
257 0.94
258 0.94
259 0.94
260 0.94
261 0.93
262 0.92
263 0.89
264 0.88
265 0.85
266 0.76
267 0.7
268 0.66
269 0.59
270 0.56
271 0.49
272 0.39
273 0.31
274 0.3
275 0.26
276 0.21
277 0.21
278 0.21
279 0.25
280 0.29
281 0.29
282 0.28
283 0.27
284 0.28
285 0.28
286 0.24
287 0.22
288 0.18