Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553I7M5

Protein Details
Accession A0A553I7M5    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-82PPGLQIKDVPKKNKKGKHTABasic
NLS Segment(s)
PositionSequence
23-26ARVK
72-80PKKNKKGKH
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 13.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEVADIKRFIEICRRKDAKSARVKKSTKSSQTKFKVRCQKKLYTLVLKDSDKAEKLKQSLPPGLQIKDVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.45
3 0.48
4 0.45
5 0.53
6 0.6
7 0.59
8 0.62
9 0.68
10 0.66
11 0.73
12 0.74
13 0.72
14 0.73
15 0.73
16 0.72
17 0.72
18 0.68
19 0.69
20 0.75
21 0.78
22 0.73
23 0.72
24 0.73
25 0.68
26 0.73
27 0.68
28 0.67
29 0.65
30 0.68
31 0.65
32 0.62
33 0.58
34 0.53
35 0.53
36 0.46
37 0.4
38 0.34
39 0.31
40 0.25
41 0.27
42 0.25
43 0.25
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.44
51 0.44
52 0.42
53 0.39
54 0.37
55 0.4
56 0.43
57 0.5
58 0.52
59 0.57
60 0.66
61 0.74
62 0.8