Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553HQ59

Protein Details
Accession A0A553HQ59    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33WKAEKHYVYYPQRKRCRPPIRIMGSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 7, E.R. 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTFMRFEVWKAEKHYVYYPQRKRCRPPIRIMGSWFGVTATWLTMWVLRVLLPALFLAWTSIAKFTRPVIYTGTSVLENCHTPLPSLSNDQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.53
4 0.59
5 0.62
6 0.65
7 0.74
8 0.78
9 0.81
10 0.83
11 0.83
12 0.8
13 0.8
14 0.8
15 0.78
16 0.74
17 0.68
18 0.61
19 0.51
20 0.44
21 0.34
22 0.24
23 0.16
24 0.12
25 0.1
26 0.06
27 0.04
28 0.04
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.08
48 0.09
49 0.09
50 0.11
51 0.12
52 0.18
53 0.19
54 0.2
55 0.21
56 0.23
57 0.23
58 0.23
59 0.23
60 0.17
61 0.16
62 0.16
63 0.15
64 0.14
65 0.15
66 0.17
67 0.15
68 0.16
69 0.18
70 0.2
71 0.21