Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553I8Y3

Protein Details
Accession A0A553I8Y3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-89RITYKLAKCCLRRRRRRQLRVARALGPEHydrophilic
NLS Segment(s)
PositionSequence
75-78RRRR
Subcellular Location(s) plas 9, mito 8, cyto 3, nucl 2, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDNIPFSTVNFDTPLLLPITSTPLSPQPSSHNGGKKAVIEPSGLATILGLSIGAILGMVFFRITYKLAKCCLRRRRRRQLRVARALGPESELPIVIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.13
4 0.11
5 0.1
6 0.15
7 0.14
8 0.13
9 0.13
10 0.18
11 0.21
12 0.22
13 0.23
14 0.23
15 0.28
16 0.33
17 0.37
18 0.38
19 0.36
20 0.38
21 0.39
22 0.35
23 0.31
24 0.29
25 0.24
26 0.18
27 0.15
28 0.15
29 0.13
30 0.11
31 0.09
32 0.07
33 0.05
34 0.05
35 0.04
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.01
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.04
50 0.06
51 0.09
52 0.13
53 0.16
54 0.22
55 0.29
56 0.36
57 0.46
58 0.56
59 0.63
60 0.71
61 0.79
62 0.85
63 0.9
64 0.93
65 0.94
66 0.95
67 0.95
68 0.94
69 0.88
70 0.82
71 0.74
72 0.65
73 0.55
74 0.47
75 0.36
76 0.28
77 0.23
78 0.17