Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553I3N5

Protein Details
Accession A0A553I3N5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
283-351IKKAELAKRHGHRERRPRLDEYRRDREKEKEERNGRYRDSYKSERERERRENYDHRHRNRHREHDRGYRBasic
NLS Segment(s)
PositionSequence
262-346KPKEVKRRPHLMGLGSKEDEEIKKAELAKRHGHRERRPRLDEYRRDREKEKEERNGRYRDSYKSERERERRENYDHRHRNRHREH
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MSSDTAPHTQAHRIAIKFGNSSSAGSKPSKNTTNASQPSSALGKRQRPNALRHDSDSGEDDDTISKHEAVTTVGVDTTATGGSDLSVGKRRKEYTISSQRNRDWKADVKGRRGDRANVSHSSSLKTQNLETAPADQDTDIKWGLNITKKSTHEDMRSPDDDPGEQRKGLSETSTELSHLPTDADRDAVDALRGKPKSAQHLIIKDSAVSNKPRLSEQDAYQRSIQEAAEVSTIEEYGEIPEGEFGAAMLRGMGWKGEEVGTKPKEVKRRPHLMGLGSKEDEEIKKAELAKRHGHRERRPRLDEYRRDREKEKEERNGRYRDSYKSERERERRENYDHRHRNRHREHDRGYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.42
4 0.39
5 0.36
6 0.34
7 0.28
8 0.29
9 0.27
10 0.25
11 0.26
12 0.28
13 0.33
14 0.33
15 0.4
16 0.45
17 0.46
18 0.48
19 0.51
20 0.58
21 0.58
22 0.57
23 0.5
24 0.44
25 0.44
26 0.44
27 0.38
28 0.35
29 0.38
30 0.43
31 0.47
32 0.55
33 0.61
34 0.61
35 0.68
36 0.7
37 0.71
38 0.66
39 0.64
40 0.61
41 0.52
42 0.48
43 0.43
44 0.35
45 0.27
46 0.23
47 0.2
48 0.17
49 0.16
50 0.17
51 0.15
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.13
58 0.11
59 0.1
60 0.09
61 0.09
62 0.08
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.08
73 0.17
74 0.19
75 0.22
76 0.28
77 0.3
78 0.33
79 0.38
80 0.41
81 0.44
82 0.53
83 0.6
84 0.61
85 0.66
86 0.67
87 0.71
88 0.68
89 0.6
90 0.54
91 0.52
92 0.54
93 0.56
94 0.57
95 0.56
96 0.6
97 0.6
98 0.61
99 0.57
100 0.54
101 0.52
102 0.52
103 0.49
104 0.45
105 0.45
106 0.42
107 0.39
108 0.37
109 0.32
110 0.31
111 0.28
112 0.27
113 0.24
114 0.25
115 0.25
116 0.24
117 0.22
118 0.19
119 0.18
120 0.17
121 0.17
122 0.12
123 0.12
124 0.11
125 0.12
126 0.1
127 0.09
128 0.08
129 0.09
130 0.12
131 0.17
132 0.18
133 0.2
134 0.26
135 0.27
136 0.32
137 0.35
138 0.37
139 0.34
140 0.37
141 0.38
142 0.38
143 0.37
144 0.34
145 0.31
146 0.27
147 0.24
148 0.23
149 0.25
150 0.21
151 0.19
152 0.18
153 0.18
154 0.19
155 0.19
156 0.16
157 0.11
158 0.11
159 0.12
160 0.12
161 0.12
162 0.1
163 0.1
164 0.1
165 0.09
166 0.07
167 0.06
168 0.08
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.09
177 0.1
178 0.16
179 0.16
180 0.16
181 0.2
182 0.22
183 0.29
184 0.3
185 0.35
186 0.33
187 0.37
188 0.39
189 0.37
190 0.34
191 0.27
192 0.25
193 0.22
194 0.2
195 0.19
196 0.19
197 0.19
198 0.2
199 0.21
200 0.23
201 0.28
202 0.28
203 0.29
204 0.37
205 0.37
206 0.38
207 0.38
208 0.36
209 0.29
210 0.27
211 0.23
212 0.14
213 0.12
214 0.11
215 0.1
216 0.1
217 0.09
218 0.08
219 0.08
220 0.06
221 0.06
222 0.05
223 0.05
224 0.06
225 0.06
226 0.05
227 0.05
228 0.06
229 0.06
230 0.05
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.03
237 0.04
238 0.04
239 0.05
240 0.04
241 0.05
242 0.06
243 0.08
244 0.09
245 0.12
246 0.21
247 0.22
248 0.24
249 0.29
250 0.33
251 0.41
252 0.48
253 0.56
254 0.56
255 0.65
256 0.66
257 0.69
258 0.68
259 0.64
260 0.63
261 0.58
262 0.54
263 0.44
264 0.41
265 0.34
266 0.33
267 0.28
268 0.23
269 0.19
270 0.15
271 0.18
272 0.23
273 0.26
274 0.29
275 0.35
276 0.42
277 0.48
278 0.57
279 0.62
280 0.68
281 0.74
282 0.78
283 0.83
284 0.84
285 0.82
286 0.8
287 0.82
288 0.83
289 0.83
290 0.81
291 0.82
292 0.79
293 0.78
294 0.75
295 0.74
296 0.73
297 0.73
298 0.73
299 0.73
300 0.74
301 0.79
302 0.83
303 0.81
304 0.75
305 0.74
306 0.69
307 0.66
308 0.66
309 0.64
310 0.66
311 0.69
312 0.74
313 0.75
314 0.81
315 0.83
316 0.85
317 0.85
318 0.83
319 0.82
320 0.83
321 0.82
322 0.84
323 0.84
324 0.83
325 0.86
326 0.87
327 0.89
328 0.89
329 0.9
330 0.89
331 0.88