Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553I2B3

Protein Details
Accession A0A553I2B3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LTNLKAKLKAVFKKKDKKPKEGASTGHydrophilic
NLS Segment(s)
PositionSequence
11-25AKLKAVFKKKDKKPK
Subcellular Location(s) cyto 5.5, cyto_nucl 5, mito 18, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MAPNALTNLKAKLKAVFKKKDKKPKEGASTGGTTEAAKVDTPAAATAAAAPAPGGEAPATEATKTEEAAKPVTETTTGTGTEAKPETPAAVADTTPEVPAAPVVAEAGAATDTKPAGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.57
4 0.63
5 0.72
6 0.81
7 0.85
8 0.84
9 0.85
10 0.85
11 0.85
12 0.84
13 0.78
14 0.72
15 0.65
16 0.59
17 0.5
18 0.4
19 0.31
20 0.21
21 0.17
22 0.14
23 0.1
24 0.08
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.06
46 0.07
47 0.06
48 0.07
49 0.08
50 0.09
51 0.09
52 0.11
53 0.12
54 0.13
55 0.14
56 0.14
57 0.13
58 0.13
59 0.13
60 0.1
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.12
67 0.12
68 0.15
69 0.15
70 0.14
71 0.13
72 0.13
73 0.13
74 0.11
75 0.12
76 0.1
77 0.1
78 0.1
79 0.1
80 0.12
81 0.12
82 0.11
83 0.11
84 0.09
85 0.08
86 0.08
87 0.08
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.07
99 0.07