Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553I939

Protein Details
Accession A0A553I939   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
359-379SPSSDRDSRKRGKKGAPYHYAHydrophilic
NLS Segment(s)
PositionSequence
367-372RKRGKK
Subcellular Location(s) cyto 6, mito 17, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR039634  Bul1-like  
Amino Acid Sequences MSIRLLPHSQVSAVIEPAQRHNKISMDIHIDNHYQSKIYTTSSTVSGHVKVKATHDVQFDTLQILLLGTSRTRIDAINIPQATSHTFLKLIMPIPDSYYPESRRFEAGTTYTIPFHFVIPQHLTLNACSHHAPNDALKDHHLRLPPSLGDWDKDDFTPNMSRVTYCVRARVYQKDSDGKSEKAMETSHDIRVIPIVAEDAPLNITQQDKMYVMSKRKTLRKSILSPKLGKVTVSASQPAPAMISSDGHCITPTTAQLDLVFEPTSNESQPPRIAGVTSKVTAVTYYSAGGINQYPNLKDWGRSFGSDGRGAYSSSVPLPATPVQSDPWRQHLTAQGRRDSGYDSALHSDSEHSANGRHSPSSDRDSRKRGKKGAPYHYAAKVLVPIELPACKKQFVPTFYSCISSRVYVLWMTVTLSGVAGMNSTITVGVPLQVGVSPGEDSRVDSTGLPTFEAAMEDDSLEIDAYLQPRTMSVPDIEFRSELPGYELRGNRMAQRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.34
5 0.4
6 0.38
7 0.38
8 0.41
9 0.39
10 0.41
11 0.42
12 0.4
13 0.39
14 0.4
15 0.4
16 0.4
17 0.39
18 0.35
19 0.35
20 0.3
21 0.22
22 0.2
23 0.22
24 0.19
25 0.21
26 0.21
27 0.2
28 0.22
29 0.24
30 0.25
31 0.24
32 0.25
33 0.27
34 0.29
35 0.3
36 0.31
37 0.3
38 0.33
39 0.39
40 0.39
41 0.4
42 0.39
43 0.38
44 0.37
45 0.36
46 0.32
47 0.24
48 0.22
49 0.16
50 0.12
51 0.1
52 0.07
53 0.07
54 0.08
55 0.07
56 0.09
57 0.09
58 0.1
59 0.11
60 0.11
61 0.14
62 0.21
63 0.26
64 0.33
65 0.32
66 0.32
67 0.31
68 0.32
69 0.3
70 0.26
71 0.22
72 0.15
73 0.15
74 0.15
75 0.17
76 0.19
77 0.19
78 0.19
79 0.19
80 0.18
81 0.22
82 0.25
83 0.26
84 0.26
85 0.31
86 0.32
87 0.37
88 0.39
89 0.37
90 0.37
91 0.35
92 0.33
93 0.31
94 0.29
95 0.26
96 0.26
97 0.25
98 0.24
99 0.22
100 0.24
101 0.19
102 0.18
103 0.18
104 0.16
105 0.2
106 0.23
107 0.25
108 0.23
109 0.24
110 0.24
111 0.21
112 0.24
113 0.19
114 0.17
115 0.16
116 0.16
117 0.17
118 0.18
119 0.18
120 0.19
121 0.24
122 0.24
123 0.24
124 0.27
125 0.29
126 0.29
127 0.32
128 0.32
129 0.27
130 0.27
131 0.3
132 0.27
133 0.23
134 0.27
135 0.23
136 0.21
137 0.22
138 0.22
139 0.2
140 0.2
141 0.21
142 0.16
143 0.18
144 0.21
145 0.19
146 0.2
147 0.19
148 0.19
149 0.18
150 0.23
151 0.27
152 0.24
153 0.29
154 0.27
155 0.32
156 0.36
157 0.43
158 0.42
159 0.39
160 0.43
161 0.45
162 0.44
163 0.48
164 0.47
165 0.39
166 0.37
167 0.36
168 0.32
169 0.26
170 0.25
171 0.19
172 0.21
173 0.23
174 0.22
175 0.2
176 0.2
177 0.18
178 0.18
179 0.17
180 0.11
181 0.08
182 0.08
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.09
195 0.08
196 0.09
197 0.13
198 0.17
199 0.22
200 0.24
201 0.29
202 0.35
203 0.42
204 0.45
205 0.48
206 0.51
207 0.54
208 0.59
209 0.64
210 0.67
211 0.65
212 0.63
213 0.58
214 0.55
215 0.48
216 0.39
217 0.3
218 0.24
219 0.22
220 0.2
221 0.2
222 0.15
223 0.16
224 0.16
225 0.14
226 0.12
227 0.08
228 0.08
229 0.06
230 0.07
231 0.07
232 0.09
233 0.09
234 0.09
235 0.09
236 0.08
237 0.09
238 0.09
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.09
245 0.09
246 0.09
247 0.09
248 0.07
249 0.08
250 0.09
251 0.1
252 0.09
253 0.1
254 0.1
255 0.12
256 0.12
257 0.13
258 0.12
259 0.11
260 0.11
261 0.11
262 0.14
263 0.14
264 0.14
265 0.13
266 0.12
267 0.12
268 0.12
269 0.12
270 0.09
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.08
277 0.09
278 0.08
279 0.1
280 0.11
281 0.11
282 0.11
283 0.16
284 0.15
285 0.16
286 0.17
287 0.21
288 0.21
289 0.21
290 0.23
291 0.24
292 0.26
293 0.26
294 0.24
295 0.2
296 0.2
297 0.19
298 0.18
299 0.14
300 0.12
301 0.1
302 0.11
303 0.09
304 0.08
305 0.12
306 0.13
307 0.14
308 0.14
309 0.14
310 0.15
311 0.19
312 0.23
313 0.22
314 0.28
315 0.29
316 0.28
317 0.3
318 0.36
319 0.42
320 0.45
321 0.48
322 0.45
323 0.43
324 0.44
325 0.42
326 0.36
327 0.28
328 0.23
329 0.19
330 0.16
331 0.18
332 0.17
333 0.17
334 0.14
335 0.15
336 0.14
337 0.14
338 0.13
339 0.11
340 0.13
341 0.14
342 0.18
343 0.18
344 0.17
345 0.17
346 0.21
347 0.25
348 0.3
349 0.37
350 0.41
351 0.47
352 0.56
353 0.64
354 0.69
355 0.73
356 0.75
357 0.75
358 0.77
359 0.8
360 0.81
361 0.79
362 0.74
363 0.71
364 0.65
365 0.59
366 0.49
367 0.39
368 0.33
369 0.25
370 0.21
371 0.16
372 0.13
373 0.13
374 0.16
375 0.18
376 0.2
377 0.21
378 0.21
379 0.22
380 0.29
381 0.34
382 0.34
383 0.39
384 0.38
385 0.41
386 0.41
387 0.44
388 0.37
389 0.32
390 0.31
391 0.24
392 0.22
393 0.17
394 0.18
395 0.14
396 0.14
397 0.13
398 0.11
399 0.11
400 0.11
401 0.1
402 0.09
403 0.08
404 0.08
405 0.08
406 0.07
407 0.06
408 0.05
409 0.05
410 0.05
411 0.05
412 0.04
413 0.04
414 0.05
415 0.05
416 0.06
417 0.06
418 0.06
419 0.07
420 0.07
421 0.08
422 0.08
423 0.09
424 0.09
425 0.09
426 0.11
427 0.11
428 0.13
429 0.14
430 0.15
431 0.15
432 0.15
433 0.18
434 0.2
435 0.2
436 0.19
437 0.16
438 0.16
439 0.15
440 0.15
441 0.14
442 0.1
443 0.1
444 0.1
445 0.1
446 0.09
447 0.09
448 0.08
449 0.07
450 0.06
451 0.08
452 0.09
453 0.1
454 0.11
455 0.1
456 0.11
457 0.14
458 0.14
459 0.15
460 0.16
461 0.2
462 0.22
463 0.25
464 0.27
465 0.25
466 0.24
467 0.27
468 0.25
469 0.2
470 0.22
471 0.22
472 0.24
473 0.32
474 0.34
475 0.33
476 0.37
477 0.39