Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553HMZ2

Protein Details
Accession A0A553HMZ2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-95IANTPPPKRCRCRSQSNSCRSCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 11.333, cyto_nucl 10.333, mito 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001876  Znf_RanBP2  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01358  ZF_RANBP2_1  
Amino Acid Sequences MEGRSNKRQRTNTNQDFDARPPVHVDDSEEWIEFDEILNFFMSNDPGNFVPSDPGELRYNPNAVETEIDRFDIANTPPPKRCRCRSQSNSCRSCACSKAGISCNESCGCGDGCGNRITRMNMNDLFGRNADGTAHKLHPCFVTQLQKMPDETFERLTLDNLFRYLKRELRPGLAEFNEDIKNWQEMWDEFEAMSSDYTGDQLLLSSRKVELQRMLLRMGLLSSEDCDLYFFSFCRGGGGWGGLGAGRLGDLDIELEQLVLGGGRWEQVDSTWHCPICRECNDWRDWHCATCNKCTYGSSKSKDYAHNELTFEGRLIIGDTFLQQNRLASGLQSYLDDLSVWYAGVLLSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.71
3 0.66
4 0.59
5 0.59
6 0.48
7 0.39
8 0.36
9 0.36
10 0.34
11 0.31
12 0.34
13 0.26
14 0.31
15 0.32
16 0.28
17 0.25
18 0.24
19 0.23
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.12
26 0.1
27 0.1
28 0.11
29 0.12
30 0.11
31 0.11
32 0.12
33 0.12
34 0.14
35 0.14
36 0.13
37 0.15
38 0.14
39 0.18
40 0.17
41 0.2
42 0.22
43 0.23
44 0.27
45 0.28
46 0.29
47 0.24
48 0.25
49 0.22
50 0.2
51 0.21
52 0.17
53 0.18
54 0.17
55 0.18
56 0.16
57 0.15
58 0.15
59 0.17
60 0.17
61 0.21
62 0.25
63 0.29
64 0.36
65 0.43
66 0.52
67 0.56
68 0.63
69 0.65
70 0.69
71 0.76
72 0.79
73 0.83
74 0.85
75 0.87
76 0.84
77 0.76
78 0.7
79 0.63
80 0.57
81 0.49
82 0.42
83 0.36
84 0.32
85 0.37
86 0.39
87 0.39
88 0.38
89 0.36
90 0.36
91 0.32
92 0.31
93 0.23
94 0.2
95 0.17
96 0.13
97 0.14
98 0.11
99 0.13
100 0.16
101 0.17
102 0.16
103 0.18
104 0.2
105 0.23
106 0.23
107 0.27
108 0.24
109 0.25
110 0.26
111 0.25
112 0.24
113 0.2
114 0.19
115 0.14
116 0.13
117 0.12
118 0.1
119 0.11
120 0.14
121 0.16
122 0.17
123 0.17
124 0.18
125 0.19
126 0.19
127 0.19
128 0.2
129 0.25
130 0.24
131 0.3
132 0.3
133 0.31
134 0.31
135 0.28
136 0.27
137 0.22
138 0.23
139 0.19
140 0.18
141 0.17
142 0.17
143 0.17
144 0.16
145 0.14
146 0.12
147 0.12
148 0.13
149 0.12
150 0.15
151 0.18
152 0.21
153 0.22
154 0.27
155 0.27
156 0.29
157 0.31
158 0.29
159 0.29
160 0.24
161 0.23
162 0.18
163 0.2
164 0.17
165 0.15
166 0.14
167 0.12
168 0.13
169 0.12
170 0.12
171 0.1
172 0.1
173 0.14
174 0.14
175 0.13
176 0.12
177 0.12
178 0.11
179 0.1
180 0.1
181 0.06
182 0.05
183 0.05
184 0.05
185 0.05
186 0.04
187 0.04
188 0.04
189 0.06
190 0.07
191 0.07
192 0.07
193 0.08
194 0.12
195 0.13
196 0.15
197 0.16
198 0.22
199 0.27
200 0.28
201 0.28
202 0.25
203 0.24
204 0.21
205 0.19
206 0.11
207 0.07
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.07
214 0.07
215 0.07
216 0.08
217 0.07
218 0.08
219 0.09
220 0.09
221 0.11
222 0.11
223 0.1
224 0.1
225 0.11
226 0.09
227 0.08
228 0.08
229 0.06
230 0.06
231 0.04
232 0.04
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.05
251 0.05
252 0.05
253 0.06
254 0.06
255 0.12
256 0.16
257 0.21
258 0.25
259 0.26
260 0.26
261 0.29
262 0.33
263 0.36
264 0.37
265 0.37
266 0.39
267 0.45
268 0.49
269 0.53
270 0.52
271 0.5
272 0.46
273 0.45
274 0.45
275 0.44
276 0.44
277 0.47
278 0.49
279 0.44
280 0.44
281 0.43
282 0.41
283 0.44
284 0.5
285 0.45
286 0.46
287 0.49
288 0.52
289 0.58
290 0.59
291 0.59
292 0.56
293 0.55
294 0.5
295 0.46
296 0.43
297 0.36
298 0.3
299 0.21
300 0.15
301 0.11
302 0.11
303 0.1
304 0.08
305 0.08
306 0.1
307 0.14
308 0.15
309 0.17
310 0.17
311 0.17
312 0.18
313 0.19
314 0.17
315 0.13
316 0.15
317 0.14
318 0.14
319 0.14
320 0.14
321 0.13
322 0.13
323 0.12
324 0.1
325 0.1
326 0.1
327 0.09
328 0.07
329 0.07
330 0.06