Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553I7L7

Protein Details
Accession A0A553I7L7   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-65ESDAHKNKKLKKTKEESRKSVBasic
NLS Segment(s)
PositionSequence
50-59KNKKLKKTKE
Subcellular Location(s) cyto 4.5, cyto_mito 8.166, cyto_nucl 9.333, mito 10.5, nucl 12
Family & Domain DBs
Amino Acid Sequences MPRSATCSTTLSLGNDSFLADDSFDYEDSTSAAVTGLPSPASSFESDAHKNKKLKKTKEESRKSVPVMNIAATGRRLHLRTGAEVEDCAQRSYQSHRKQSLAEDPSKTFVYELCNRQFRRQEHLRVEGGGADGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.14
5 0.12
6 0.11
7 0.08
8 0.07
9 0.08
10 0.1
11 0.09
12 0.1
13 0.09
14 0.09
15 0.09
16 0.09
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.09
29 0.09
30 0.1
31 0.11
32 0.17
33 0.21
34 0.27
35 0.31
36 0.36
37 0.4
38 0.47
39 0.55
40 0.6
41 0.64
42 0.68
43 0.73
44 0.76
45 0.82
46 0.83
47 0.79
48 0.77
49 0.74
50 0.65
51 0.59
52 0.5
53 0.42
54 0.34
55 0.28
56 0.22
57 0.16
58 0.16
59 0.12
60 0.12
61 0.1
62 0.12
63 0.12
64 0.11
65 0.16
66 0.16
67 0.17
68 0.19
69 0.19
70 0.17
71 0.16
72 0.17
73 0.16
74 0.16
75 0.15
76 0.12
77 0.11
78 0.13
79 0.21
80 0.29
81 0.34
82 0.42
83 0.46
84 0.48
85 0.49
86 0.53
87 0.54
88 0.51
89 0.48
90 0.43
91 0.41
92 0.42
93 0.41
94 0.36
95 0.26
96 0.21
97 0.23
98 0.27
99 0.32
100 0.37
101 0.45
102 0.47
103 0.55
104 0.62
105 0.58
106 0.6
107 0.63
108 0.65
109 0.64
110 0.68
111 0.62
112 0.55
113 0.52
114 0.44