Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553IB62

Protein Details
Accession A0A553IB62    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-90YIHFATMKPEQKKKKEKKKDEKKPGGKPPAQRBasic
NLS Segment(s)
PositionSequence
68-90EQKKKKEKKKDEKKPGGKPPAQR
Subcellular Location(s) E.R. 7, plas 6, cyto 4, mito 3, extr 3, golg 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSASAPAFSSSLNSGQFDWLGKIGATREAIATLNDQPYVFFVLVAALVILILEGVFIWYIHFATMKPEQKKKKEKKKDEKKPGGKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.17
5 0.16
6 0.13
7 0.12
8 0.1
9 0.11
10 0.1
11 0.13
12 0.12
13 0.11
14 0.11
15 0.11
16 0.12
17 0.11
18 0.13
19 0.12
20 0.12
21 0.12
22 0.12
23 0.1
24 0.11
25 0.12
26 0.1
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.02
34 0.02
35 0.02
36 0.02
37 0.01
38 0.01
39 0.01
40 0.01
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.04
48 0.05
49 0.05
50 0.09
51 0.18
52 0.26
53 0.32
54 0.41
55 0.51
56 0.61
57 0.72
58 0.78
59 0.82
60 0.85
61 0.9
62 0.93
63 0.95
64 0.96
65 0.96
66 0.97
67 0.96
68 0.95
69 0.94
70 0.94