Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553IBT0

Protein Details
Accession A0A553IBT0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-38VRTDYRPVVRARPKPKRKRHARGIIYQRKQKBasic
NLS Segment(s)
PositionSequence
17-52RARPKPKRKRHARGIIYQRKQKARDKINASRSPAKR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MNDYRPAVRTDYRPVVRARPKPKRKRHARGIIYQRKQKARDKINASRSPAKRSSALTTFIPDPPSVDPTNTSQLMLLANSAQMMAILLRQDGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.58
4 0.63
5 0.65
6 0.66
7 0.75
8 0.81
9 0.89
10 0.9
11 0.92
12 0.93
13 0.93
14 0.93
15 0.89
16 0.88
17 0.88
18 0.88
19 0.84
20 0.8
21 0.76
22 0.71
23 0.7
24 0.67
25 0.65
26 0.63
27 0.64
28 0.66
29 0.67
30 0.71
31 0.7
32 0.68
33 0.68
34 0.62
35 0.59
36 0.54
37 0.47
38 0.4
39 0.37
40 0.37
41 0.31
42 0.32
43 0.26
44 0.26
45 0.25
46 0.25
47 0.24
48 0.18
49 0.17
50 0.16
51 0.2
52 0.18
53 0.17
54 0.17
55 0.19
56 0.25
57 0.24
58 0.22
59 0.18
60 0.18
61 0.18
62 0.16
63 0.13
64 0.08
65 0.07
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06