Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553HLI1

Protein Details
Accession A0A553HLI1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
63-87KAHANARRAKSRRRQQRRRGYISPYHydrophilic
120-139ASEPKKPKTTSKIRSRPLATHydrophilic
NLS Segment(s)
PositionSequence
64-81AHANARRAKSRRRQQRRR
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MRSKKVRLPSGVFRRHRSTSRSLITAELKSYLTGSGNLHLARPIKSDRDCCHWHQWWNSRGDKAHANARRAKSRRRQQRRRGYISPYHESPVDLEKYDDDMDKLNADAACWVNGYDQCRASEPKKPKTTSKIRSRPLATGCAANFELFGDSITIAFRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.7
4 0.65
5 0.62
6 0.61
7 0.6
8 0.56
9 0.5
10 0.48
11 0.47
12 0.42
13 0.36
14 0.28
15 0.23
16 0.21
17 0.2
18 0.16
19 0.12
20 0.13
21 0.13
22 0.13
23 0.16
24 0.15
25 0.15
26 0.17
27 0.18
28 0.17
29 0.2
30 0.21
31 0.24
32 0.28
33 0.34
34 0.34
35 0.4
36 0.43
37 0.45
38 0.51
39 0.5
40 0.52
41 0.53
42 0.59
43 0.58
44 0.6
45 0.58
46 0.52
47 0.48
48 0.45
49 0.41
50 0.35
51 0.37
52 0.36
53 0.37
54 0.4
55 0.43
56 0.5
57 0.49
58 0.56
59 0.57
60 0.62
61 0.69
62 0.74
63 0.8
64 0.81
65 0.89
66 0.9
67 0.88
68 0.83
69 0.78
70 0.74
71 0.7
72 0.64
73 0.54
74 0.46
75 0.37
76 0.33
77 0.27
78 0.24
79 0.19
80 0.14
81 0.13
82 0.12
83 0.14
84 0.15
85 0.14
86 0.1
87 0.1
88 0.11
89 0.1
90 0.1
91 0.1
92 0.09
93 0.09
94 0.11
95 0.1
96 0.1
97 0.1
98 0.1
99 0.1
100 0.12
101 0.15
102 0.16
103 0.17
104 0.18
105 0.21
106 0.25
107 0.26
108 0.32
109 0.39
110 0.46
111 0.53
112 0.56
113 0.61
114 0.67
115 0.75
116 0.77
117 0.79
118 0.79
119 0.77
120 0.82
121 0.77
122 0.74
123 0.67
124 0.63
125 0.53
126 0.49
127 0.42
128 0.38
129 0.35
130 0.28
131 0.24
132 0.19
133 0.18
134 0.13
135 0.13
136 0.09
137 0.08
138 0.08