Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553IDY0

Protein Details
Accession A0A553IDY0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-90KMYKTRLAKWKMLKNRPRGSGHHydrophilic
NLS Segment(s)
PositionSequence
82-84KNR
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MPTHAMSINNLCNDYTQDDYSRSHLDWATPEDWDAHQETIRRLYLDEKRPLKEVVVIMESEYGFRATAKMYKTRLAKWKMLKNRPRGSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.2
5 0.21
6 0.23
7 0.25
8 0.26
9 0.23
10 0.22
11 0.2
12 0.2
13 0.2
14 0.23
15 0.2
16 0.17
17 0.17
18 0.16
19 0.16
20 0.16
21 0.15
22 0.11
23 0.12
24 0.14
25 0.15
26 0.17
27 0.18
28 0.16
29 0.15
30 0.2
31 0.26
32 0.31
33 0.38
34 0.38
35 0.39
36 0.41
37 0.41
38 0.35
39 0.31
40 0.25
41 0.19
42 0.17
43 0.15
44 0.13
45 0.14
46 0.14
47 0.1
48 0.1
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.12
55 0.15
56 0.21
57 0.23
58 0.3
59 0.34
60 0.41
61 0.49
62 0.51
63 0.57
64 0.59
65 0.67
66 0.72
67 0.78
68 0.79
69 0.81
70 0.83