Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553HWQ8

Protein Details
Accession A0A553HWQ8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MRKPGKVKRVKHKVDYRHRWPTQQTBasic
NLS Segment(s)
PositionSequence
4-11PGKVKRVK
47-56RLLRRLKRRS
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MRKPGKVKRVKHKVDYRHRWPTQQTLIESRVSVDASRTKWQWKPGVRLLRRLKRRSSPEPGKSTHPYDTGITGQGSGSGSSSSPSSTSQALGDGLGYWKMFTRPPTPPPAAPSPAPMPNFSHVRDETRSETSKTPVQYLRLLANPFPRSRTATPSDFDKATVKSTRSRVQTPAPPPMPSQPVVDSSKTLSSRLKCITKNIFRRPGLGWACS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.89
4 0.89
5 0.84
6 0.81
7 0.76
8 0.75
9 0.72
10 0.68
11 0.62
12 0.58
13 0.56
14 0.5
15 0.45
16 0.36
17 0.29
18 0.23
19 0.19
20 0.17
21 0.2
22 0.22
23 0.27
24 0.28
25 0.33
26 0.36
27 0.44
28 0.49
29 0.5
30 0.55
31 0.59
32 0.67
33 0.64
34 0.7
35 0.73
36 0.74
37 0.77
38 0.75
39 0.74
40 0.72
41 0.78
42 0.76
43 0.77
44 0.77
45 0.76
46 0.76
47 0.71
48 0.68
49 0.64
50 0.6
51 0.52
52 0.43
53 0.36
54 0.31
55 0.3
56 0.25
57 0.21
58 0.17
59 0.14
60 0.12
61 0.11
62 0.11
63 0.09
64 0.08
65 0.06
66 0.06
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.09
73 0.09
74 0.1
75 0.09
76 0.1
77 0.09
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.06
87 0.08
88 0.11
89 0.15
90 0.19
91 0.22
92 0.29
93 0.31
94 0.31
95 0.33
96 0.35
97 0.32
98 0.29
99 0.28
100 0.25
101 0.28
102 0.28
103 0.25
104 0.23
105 0.23
106 0.26
107 0.24
108 0.26
109 0.22
110 0.25
111 0.26
112 0.27
113 0.27
114 0.29
115 0.3
116 0.28
117 0.29
118 0.28
119 0.3
120 0.28
121 0.29
122 0.26
123 0.27
124 0.27
125 0.27
126 0.26
127 0.27
128 0.27
129 0.24
130 0.3
131 0.31
132 0.29
133 0.3
134 0.29
135 0.32
136 0.33
137 0.37
138 0.35
139 0.35
140 0.35
141 0.38
142 0.39
143 0.33
144 0.32
145 0.29
146 0.25
147 0.27
148 0.3
149 0.27
150 0.3
151 0.36
152 0.41
153 0.43
154 0.46
155 0.45
156 0.49
157 0.55
158 0.54
159 0.58
160 0.54
161 0.5
162 0.49
163 0.5
164 0.47
165 0.4
166 0.37
167 0.29
168 0.32
169 0.35
170 0.34
171 0.29
172 0.27
173 0.33
174 0.31
175 0.31
176 0.33
177 0.32
178 0.38
179 0.44
180 0.49
181 0.44
182 0.52
183 0.6
184 0.63
185 0.71
186 0.74
187 0.76
188 0.7
189 0.71
190 0.65
191 0.64