Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553HXF8

Protein Details
Accession A0A553HXF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-54TASRGFRRPNRHHTTRRRLIBasic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MNHQHNTPLQIDRYCGAASRRLSIVFLRLVPPASTASRGFRRPNRHHTTRRRLIVHTIHKRYPAYTVDLQAAVPTPWVSGIIEAPAFSPKAPVRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.23
5 0.23
6 0.25
7 0.26
8 0.23
9 0.24
10 0.22
11 0.24
12 0.19
13 0.18
14 0.16
15 0.16
16 0.16
17 0.15
18 0.15
19 0.15
20 0.14
21 0.15
22 0.15
23 0.2
24 0.23
25 0.27
26 0.32
27 0.36
28 0.46
29 0.51
30 0.6
31 0.64
32 0.68
33 0.74
34 0.78
35 0.82
36 0.8
37 0.79
38 0.72
39 0.64
40 0.62
41 0.61
42 0.61
43 0.61
44 0.58
45 0.53
46 0.54
47 0.53
48 0.47
49 0.42
50 0.34
51 0.3
52 0.27
53 0.26
54 0.24
55 0.24
56 0.23
57 0.19
58 0.18
59 0.12
60 0.1
61 0.08
62 0.07
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.09
69 0.09
70 0.09
71 0.1
72 0.12
73 0.12
74 0.11
75 0.17