Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553I7L5

Protein Details
Accession A0A553I7L5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-48IMQLQKPKGEKKEKPKDKKMEKKPEEPKGDNBasic
NLS Segment(s)
PositionSequence
23-64KPKGEKKEKPKDKKMEKKPEEPKGDNKDKSLPLSNRKKKKML
Subcellular Location(s) cyto 5, cyto_mito 8.833, cyto_nucl 7.833, mito 11.5, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MLIFARSAFPFMILHKHIMQLQKPKGEKKEKPKDKKMEKKPEEPKGDNKDKSLPLSNRKKKKMLRQLAWLDRKLAASAAAQEKEKEKCKDKGEVEVKVEMATW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.27
5 0.32
6 0.36
7 0.39
8 0.42
9 0.47
10 0.5
11 0.55
12 0.61
13 0.65
14 0.68
15 0.69
16 0.75
17 0.78
18 0.84
19 0.87
20 0.88
21 0.89
22 0.91
23 0.91
24 0.91
25 0.87
26 0.87
27 0.86
28 0.85
29 0.82
30 0.75
31 0.73
32 0.71
33 0.73
34 0.64
35 0.57
36 0.53
37 0.46
38 0.45
39 0.44
40 0.39
41 0.4
42 0.5
43 0.57
44 0.6
45 0.64
46 0.7
47 0.69
48 0.75
49 0.76
50 0.76
51 0.72
52 0.72
53 0.76
54 0.77
55 0.77
56 0.67
57 0.58
58 0.49
59 0.45
60 0.35
61 0.26
62 0.18
63 0.12
64 0.16
65 0.19
66 0.2
67 0.2
68 0.21
69 0.25
70 0.3
71 0.38
72 0.4
73 0.41
74 0.47
75 0.51
76 0.59
77 0.58
78 0.62
79 0.62
80 0.62
81 0.59
82 0.54
83 0.49