Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553I2K3

Protein Details
Accession A0A553I2K3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-37QSPEPLPKPKSKPSTRYRRRHRQELNWDFPKLHydrophilic
NLS Segment(s)
PositionSequence
13-26KPKSKPSTRYRRRH
Subcellular Location(s) plas 11, nucl 6, mito 5, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADKEQSPEPLPKPKSKPSTRYRRRHRQELNWDFPKLEFKNLSTPQLTASRAIGVLLFYATYLRYFSNVSRAPSGNFVLPPITRGGGGGDVDVGSEIFSKKFLVEFYLALLVGVLYLWPFWNAYRKGSTFNSFVRSCASSWSVSLVIYLSFLKLIQHYGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.72
4 0.77
5 0.78
6 0.84
7 0.86
8 0.89
9 0.9
10 0.91
11 0.91
12 0.92
13 0.91
14 0.9
15 0.91
16 0.91
17 0.9
18 0.84
19 0.75
20 0.65
21 0.56
22 0.54
23 0.44
24 0.39
25 0.31
26 0.27
27 0.36
28 0.38
29 0.41
30 0.33
31 0.32
32 0.29
33 0.31
34 0.3
35 0.22
36 0.2
37 0.16
38 0.15
39 0.15
40 0.12
41 0.08
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.08
53 0.08
54 0.16
55 0.19
56 0.2
57 0.23
58 0.23
59 0.23
60 0.24
61 0.25
62 0.17
63 0.15
64 0.13
65 0.12
66 0.11
67 0.11
68 0.09
69 0.09
70 0.07
71 0.07
72 0.08
73 0.07
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.07
89 0.07
90 0.09
91 0.1
92 0.1
93 0.1
94 0.11
95 0.11
96 0.1
97 0.09
98 0.06
99 0.05
100 0.05
101 0.03
102 0.02
103 0.03
104 0.03
105 0.04
106 0.05
107 0.06
108 0.15
109 0.16
110 0.2
111 0.25
112 0.26
113 0.31
114 0.35
115 0.38
116 0.35
117 0.36
118 0.39
119 0.34
120 0.34
121 0.32
122 0.3
123 0.26
124 0.26
125 0.25
126 0.2
127 0.2
128 0.22
129 0.19
130 0.17
131 0.17
132 0.13
133 0.1
134 0.11
135 0.11
136 0.08
137 0.08
138 0.08
139 0.09
140 0.1
141 0.12