Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A553I4S0

Protein Details
Accession A0A553I4S0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-66EPDEHSNKHKKHKKDKKHQKLDKHDKHDKYEKDKKYKKDSSSSBasic
NLS Segment(s)
PositionSequence
31-67KHKKHKKDKKHQKLDKHDKHDKYEKDKKYKKDSSSSG
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MAGKKYSIYHKVVDGKTVKDATAEPDEHSNKHKKHKKDKKHQKLDKHDKHDKYEKDKKYKKDSSSSGPTRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.41
4 0.4
5 0.33
6 0.25
7 0.25
8 0.22
9 0.24
10 0.23
11 0.19
12 0.25
13 0.27
14 0.27
15 0.32
16 0.36
17 0.35
18 0.44
19 0.51
20 0.53
21 0.63
22 0.73
23 0.78
24 0.81
25 0.89
26 0.9
27 0.93
28 0.92
29 0.91
30 0.92
31 0.92
32 0.9
33 0.88
34 0.86
35 0.8
36 0.8
37 0.79
38 0.75
39 0.73
40 0.74
41 0.74
42 0.76
43 0.79
44 0.8
45 0.82
46 0.83
47 0.8
48 0.8
49 0.77
50 0.75
51 0.78
52 0.78