Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553ICN5

Protein Details
Accession A0A553ICN5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTERIQTWQKKNKVHLKRLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MTERIQTWQKKNKVHLKRLAALIRKIISVTKGCGNRAKVCYVPDGDKLVISPLDGEKMLPEDLYLKWEAEPNYPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.77
4 0.75
5 0.75
6 0.72
7 0.68
8 0.59
9 0.54
10 0.46
11 0.38
12 0.33
13 0.27
14 0.22
15 0.18
16 0.18
17 0.19
18 0.21
19 0.22
20 0.27
21 0.29
22 0.31
23 0.32
24 0.32
25 0.28
26 0.27
27 0.27
28 0.24
29 0.24
30 0.2
31 0.21
32 0.19
33 0.17
34 0.16
35 0.15
36 0.13
37 0.1
38 0.09
39 0.07
40 0.09
41 0.09
42 0.09
43 0.08
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.1
50 0.13
51 0.14
52 0.12
53 0.13
54 0.18
55 0.19
56 0.22