Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A553I1J2

Protein Details
Accession A0A553I1J2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-66QEKAKVPKGRAKKRLQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
45-56KAKVPKGRAKKR
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKLQASHPLATTRLSLLNISTTTNHLAEVEKQEKAKVPKGRAKKRLQYTRRFVNVTLTGGKRKMNPNPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.27
4 0.25
5 0.25
6 0.27
7 0.25
8 0.24
9 0.23
10 0.17
11 0.14
12 0.14
13 0.13
14 0.12
15 0.13
16 0.12
17 0.12
18 0.12
19 0.11
20 0.13
21 0.12
22 0.12
23 0.1
24 0.1
25 0.11
26 0.17
27 0.17
28 0.17
29 0.17
30 0.18
31 0.22
32 0.25
33 0.31
34 0.31
35 0.36
36 0.42
37 0.53
38 0.62
39 0.68
40 0.73
41 0.75
42 0.79
43 0.83
44 0.85
45 0.84
46 0.82
47 0.82
48 0.8
49 0.73
50 0.63
51 0.6
52 0.54
53 0.48
54 0.46
55 0.39
56 0.38
57 0.37
58 0.4
59 0.38
60 0.43
61 0.49