Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L7N6

Protein Details
Accession E2L7N6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-44EASLKKLNAKKRTTKREKAEIVDHydrophilic
NLS Segment(s)
PositionSequence
31-36KKRTTK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 3
Family & Domain DBs
KEGG mpr:MPER_01904  -  
Amino Acid Sequences SQWPQQAGILHGEKVLDIEIAEASLKKLNAKKRTTKREKAEIVDLETKLGQLRAEKGQASQKVDELTARLKTLEAKDRDLTGTLQEKAKAAERQQNTDSELSELSENEDSQEEKSEEEKSDERAKLNMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.09
4 0.06
5 0.07
6 0.06
7 0.06
8 0.07
9 0.06
10 0.07
11 0.1
12 0.11
13 0.15
14 0.21
15 0.3
16 0.38
17 0.46
18 0.55
19 0.63
20 0.74
21 0.79
22 0.84
23 0.83
24 0.84
25 0.82
26 0.75
27 0.72
28 0.63
29 0.58
30 0.53
31 0.44
32 0.35
33 0.29
34 0.25
35 0.18
36 0.16
37 0.12
38 0.08
39 0.11
40 0.12
41 0.14
42 0.14
43 0.16
44 0.22
45 0.25
46 0.26
47 0.24
48 0.23
49 0.22
50 0.21
51 0.19
52 0.15
53 0.13
54 0.11
55 0.11
56 0.1
57 0.09
58 0.12
59 0.16
60 0.22
61 0.22
62 0.25
63 0.26
64 0.27
65 0.27
66 0.25
67 0.22
68 0.18
69 0.2
70 0.18
71 0.19
72 0.19
73 0.19
74 0.19
75 0.24
76 0.24
77 0.24
78 0.3
79 0.32
80 0.36
81 0.38
82 0.39
83 0.36
84 0.34
85 0.3
86 0.23
87 0.21
88 0.17
89 0.15
90 0.13
91 0.13
92 0.13
93 0.12
94 0.12
95 0.13
96 0.13
97 0.13
98 0.18
99 0.16
100 0.16
101 0.18
102 0.2
103 0.2
104 0.25
105 0.26
106 0.27
107 0.35
108 0.36
109 0.36