Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507E811

Protein Details
Accession A0A507E811    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-177EDGGKVKFRRPKAKKAHLSSAAEEKRRKLNRKKKESLKDVKKIKNKKLLSFGDBasic
NLS Segment(s)
PositionSequence
129-171KVKFRRPKAKKAHLSSAAEEKRRKLNRKKKESLKDVKKIKNKK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
IPR040219  KIAA1143-like  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MREKKMNFNARQSLQFQAETPNFLKLLQSAVNPPGRQRKDRSIPNFEGGSDDDDNDDDSGPDVPERDDEKPQIVVEKGITDMEVRRFRGEDAKSADDGRKRAADADSGNESGKQGEDTSGAEDAEDGGKVKFRRPKAKKAHLSSAAEEKRRKLNRKKKESLKDVKKIKNKKLLSFGDEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.37
4 0.36
5 0.33
6 0.33
7 0.31
8 0.28
9 0.25
10 0.24
11 0.24
12 0.16
13 0.19
14 0.16
15 0.17
16 0.17
17 0.23
18 0.29
19 0.28
20 0.33
21 0.4
22 0.43
23 0.48
24 0.51
25 0.56
26 0.59
27 0.69
28 0.72
29 0.71
30 0.69
31 0.67
32 0.61
33 0.51
34 0.44
35 0.35
36 0.31
37 0.22
38 0.18
39 0.14
40 0.14
41 0.14
42 0.12
43 0.11
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.1
52 0.13
53 0.15
54 0.17
55 0.18
56 0.19
57 0.2
58 0.2
59 0.19
60 0.16
61 0.14
62 0.12
63 0.11
64 0.1
65 0.09
66 0.09
67 0.07
68 0.08
69 0.14
70 0.18
71 0.18
72 0.18
73 0.19
74 0.19
75 0.26
76 0.25
77 0.23
78 0.24
79 0.25
80 0.25
81 0.26
82 0.28
83 0.24
84 0.24
85 0.21
86 0.18
87 0.16
88 0.17
89 0.17
90 0.17
91 0.15
92 0.17
93 0.18
94 0.17
95 0.17
96 0.16
97 0.15
98 0.12
99 0.12
100 0.09
101 0.07
102 0.06
103 0.07
104 0.08
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.1
116 0.11
117 0.17
118 0.23
119 0.31
120 0.42
121 0.48
122 0.59
123 0.66
124 0.76
125 0.8
126 0.81
127 0.83
128 0.8
129 0.78
130 0.7
131 0.7
132 0.65
133 0.62
134 0.57
135 0.51
136 0.53
137 0.58
138 0.65
139 0.66
140 0.7
141 0.74
142 0.83
143 0.89
144 0.9
145 0.92
146 0.92
147 0.92
148 0.92
149 0.91
150 0.9
151 0.89
152 0.89
153 0.88
154 0.87
155 0.86
156 0.82
157 0.8
158 0.8
159 0.77
160 0.73