Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507E8B3

Protein Details
Accession A0A507E8B3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
376-397ALPSSAKSKNPQQPQKPGKSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022088  Intraflagellar_transp_cmplxB  
Gene Ontology GO:0005929  C:cilium  
GO:0005737  C:cytoplasm  
GO:0005856  C:cytoskeleton  
GO:0042073  P:intraciliary transport  
Pfam View protein in Pfam  
PF12317  IFT46_B_C  
Amino Acid Sequences MYEGFSKENDSDSSGDSFESQLRTTKVTNNYYDEIIELSGSELDEFPTPTESRIEDHEGSQHSKSMEGDILHERGDSPPSANLSQTDEDYDEEDDEEDEEEEEAPIVLRPSHTGRPSAAPAGRGGLGIPAPGGLGPDPNDGTGSIGTKPINVLGDDFDDEIDEHDSIAFNNTGGLGGFPASTTSSNNSTGVPVSEELKELFQYIQRHKPQETELETELKAFIPDYVPAIGDIDAFIKIPRPDKIPDLLGLTFLDEPSANQSDPTVLDLRLRAITKSTTASAPVTVRSLEAAALKANPKLIDSWIKNIRDLHAQKPPQTVHYTKKMPEIEDLMQVWPTEFEEALTQVNLPPAELDTPLPQYAQLLSLLLDIPISGPALPSSAKSKNPQQPQKPGKSLSSGSTHVVEALHIMFTLYSEFSNSAHFKALGRTVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.18
5 0.18
6 0.19
7 0.18
8 0.21
9 0.22
10 0.25
11 0.27
12 0.33
13 0.39
14 0.43
15 0.47
16 0.48
17 0.48
18 0.46
19 0.44
20 0.36
21 0.28
22 0.22
23 0.16
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.07
30 0.09
31 0.1
32 0.11
33 0.11
34 0.14
35 0.15
36 0.15
37 0.18
38 0.17
39 0.18
40 0.22
41 0.28
42 0.25
43 0.26
44 0.31
45 0.32
46 0.35
47 0.34
48 0.32
49 0.26
50 0.26
51 0.25
52 0.22
53 0.22
54 0.18
55 0.21
56 0.22
57 0.23
58 0.21
59 0.21
60 0.19
61 0.17
62 0.19
63 0.16
64 0.13
65 0.15
66 0.19
67 0.2
68 0.2
69 0.2
70 0.23
71 0.23
72 0.22
73 0.21
74 0.18
75 0.18
76 0.18
77 0.18
78 0.13
79 0.12
80 0.11
81 0.1
82 0.09
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.07
96 0.1
97 0.15
98 0.21
99 0.23
100 0.24
101 0.26
102 0.29
103 0.32
104 0.35
105 0.32
106 0.26
107 0.25
108 0.25
109 0.23
110 0.19
111 0.16
112 0.11
113 0.09
114 0.08
115 0.08
116 0.06
117 0.05
118 0.05
119 0.06
120 0.04
121 0.06
122 0.07
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.1
130 0.1
131 0.09
132 0.11
133 0.11
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.1
140 0.09
141 0.1
142 0.11
143 0.11
144 0.09
145 0.08
146 0.08
147 0.08
148 0.08
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.08
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.06
169 0.07
170 0.09
171 0.11
172 0.13
173 0.14
174 0.13
175 0.13
176 0.13
177 0.12
178 0.11
179 0.09
180 0.09
181 0.09
182 0.1
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.11
189 0.16
190 0.2
191 0.28
192 0.32
193 0.35
194 0.35
195 0.37
196 0.35
197 0.37
198 0.36
199 0.31
200 0.28
201 0.28
202 0.27
203 0.25
204 0.23
205 0.16
206 0.12
207 0.08
208 0.07
209 0.05
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.07
216 0.07
217 0.06
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.08
224 0.09
225 0.12
226 0.13
227 0.16
228 0.18
229 0.2
230 0.23
231 0.21
232 0.21
233 0.22
234 0.2
235 0.17
236 0.16
237 0.14
238 0.12
239 0.1
240 0.09
241 0.06
242 0.06
243 0.1
244 0.11
245 0.1
246 0.1
247 0.1
248 0.11
249 0.11
250 0.13
251 0.11
252 0.09
253 0.11
254 0.11
255 0.13
256 0.15
257 0.16
258 0.13
259 0.13
260 0.14
261 0.14
262 0.16
263 0.16
264 0.13
265 0.14
266 0.15
267 0.15
268 0.15
269 0.14
270 0.14
271 0.12
272 0.12
273 0.11
274 0.1
275 0.09
276 0.09
277 0.09
278 0.08
279 0.1
280 0.12
281 0.12
282 0.13
283 0.12
284 0.12
285 0.13
286 0.15
287 0.22
288 0.23
289 0.3
290 0.35
291 0.36
292 0.38
293 0.39
294 0.37
295 0.39
296 0.4
297 0.38
298 0.4
299 0.43
300 0.44
301 0.5
302 0.49
303 0.44
304 0.47
305 0.46
306 0.43
307 0.49
308 0.5
309 0.45
310 0.52
311 0.51
312 0.46
313 0.44
314 0.43
315 0.36
316 0.35
317 0.34
318 0.26
319 0.24
320 0.22
321 0.19
322 0.14
323 0.13
324 0.1
325 0.08
326 0.08
327 0.08
328 0.09
329 0.1
330 0.1
331 0.09
332 0.09
333 0.12
334 0.12
335 0.1
336 0.1
337 0.1
338 0.11
339 0.12
340 0.12
341 0.12
342 0.16
343 0.16
344 0.16
345 0.15
346 0.14
347 0.14
348 0.14
349 0.11
350 0.09
351 0.08
352 0.09
353 0.1
354 0.08
355 0.07
356 0.06
357 0.06
358 0.06
359 0.06
360 0.05
361 0.06
362 0.06
363 0.08
364 0.08
365 0.1
366 0.16
367 0.21
368 0.26
369 0.32
370 0.42
371 0.49
372 0.6
373 0.69
374 0.71
375 0.77
376 0.83
377 0.87
378 0.84
379 0.8
380 0.73
381 0.69
382 0.63
383 0.56
384 0.52
385 0.44
386 0.39
387 0.36
388 0.32
389 0.26
390 0.24
391 0.19
392 0.15
393 0.13
394 0.11
395 0.09
396 0.09
397 0.07
398 0.08
399 0.09
400 0.08
401 0.08
402 0.09
403 0.1
404 0.11
405 0.18
406 0.19
407 0.19
408 0.22
409 0.23
410 0.23
411 0.28
412 0.32