FuNGI

A0A507EDV5

Protein Details

Accession

A0A507EDV5

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
413-436	AGHSCYRPRRTGERKRKSVRGCIV	Hydrophilic
459-480	TDTQIPKRLGPKRANNIRKMFN	Hydrophilic
518-537	RTIQRKRHLKALKVRQSLKV	Hydrophilic
547-569	LLAQRIKERNSKRQELHMKRRLS	Hydrophilic

NLS Segment(s)

Position	Sequence
80-97	RSAPPPPTPPPPRAKPVK
425-428	ERKR
494-529	REIPGKGDKKSYTKAPKIQRLVTPRTIQRKRHLKAL

Subcellular Location(s)

nucl 19.5, cyto_nucl 12, cyto 3.5, mito 1, plas 1, pero 1, cysk 1

Family & Domain DBs

InterPro	View protein in InterPro IPR001377 Ribosomal_S6e IPR020924 Ribosomal_S6e_arc IPR018282 Ribosomal_S6e_CS
Gene Ontology	GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0003735 F:structural constituent of ribosome GO:0006412 P:translation
Pfam	View protein in Pfam PF01092 Ribosomal_S6e
PROSITE	View protein in PROSITE PS00578 RIBOSOMAL_S6E

Amino Acid Sequences

MHGPRSPLLDDPKHSLSNKPLSRRRGVTKTIPFNDPSQTKSTRTPIKPPTTVKPPWNFDPPPPAPKTIRILPERRSLATRSAPPPPTPPPPRAKPVKSTAARRPIQDLASNLSQTIERGERLLENNELEILRAERDQYKAAFLQAEGERRFLCEYLISQEEAVRDTRAGSPTGSASRNRMGPKALQAALEDCLRAATEDDAAAKETQRTVSQLKKALGQSEANVAFMAGQLTEAASKQRKDALALEMLEMELGVLRAGRDSAIDVDSERDESYRNDTATQTCWEVVQYDDDVGSMQGPMSMSPSPSEMSSTSPSNSLTSKGLTSPCKDTRAISDVWLNIAYPALGTQKSIEIDDERKYRIFYEKRMSQEVKGDALGDEFKGYVFKITGGNDKQGFPMKQGILEARRVRLLLSAGHSCYRPRRTGERKRKSVRGCIVASDISALALVVVKQGEADIPGLTDTQIPKRLGPKRANNIRKMFNLTKEDDVRKYVIRREIPGKGDKKSYTKAPKIQRLVTPRTIQRKRHLKALKVRQSLKVAEDAANYAHLLAQRIKERNSKRQELHMKRRLSSTRKSTVQA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.51
2	0.5
3	0.5
4	0.54
5	0.58
6	0.61
7	0.64
8	0.66
9	0.73
10	0.75
11	0.76
12	0.74
13	0.74
14	0.74
15	0.76
16	0.79
17	0.75
18	0.71
19	0.64
20	0.58
21	0.6
22	0.52
23	0.46
24	0.42
25	0.42
26	0.41
27	0.46
28	0.52
29	0.54
30	0.56
31	0.61
32	0.65
33	0.7
34	0.74
35	0.73
36	0.73
37	0.71
38	0.74
39	0.73
40	0.72
41	0.69
42	0.67
43	0.7
44	0.64
45	0.59
46	0.63
47	0.6
48	0.59
49	0.56
50	0.56
51	0.5
52	0.53
53	0.56
54	0.52
55	0.55
56	0.54
57	0.57
58	0.57
59	0.63
60	0.61
61	0.57
62	0.54
63	0.48
64	0.47
65	0.48
66	0.5
67	0.45
68	0.5
69	0.51
70	0.5
71	0.53
72	0.52
73	0.55
74	0.53
75	0.56
76	0.57
77	0.6
78	0.67
79	0.71
80	0.7
81	0.68
82	0.7
83	0.72
84	0.7
85	0.72
86	0.72
87	0.73
88	0.7
89	0.64
90	0.62
91	0.56
92	0.51
93	0.47
94	0.39
95	0.35
96	0.35
97	0.33
98	0.28
99	0.24
100	0.21
101	0.18
102	0.2
103	0.16
104	0.12
105	0.13
106	0.14
107	0.16
108	0.19
109	0.22
110	0.2
111	0.19
112	0.19
113	0.2
114	0.19
115	0.16
116	0.14
117	0.12
118	0.11
119	0.11
120	0.13
121	0.14
122	0.16
123	0.19
124	0.18
125	0.21
126	0.2
127	0.21
128	0.2
129	0.17
130	0.21
131	0.21
132	0.28
133	0.25
134	0.26
135	0.24
136	0.25
137	0.27
138	0.2
139	0.18
140	0.12
141	0.12
142	0.15
143	0.17
144	0.15
145	0.14
146	0.16
147	0.16
148	0.16
149	0.16
150	0.12
151	0.1
152	0.12
153	0.15
154	0.15
155	0.15
156	0.14
157	0.15
158	0.16
159	0.21
160	0.21
161	0.19
162	0.21
163	0.24
164	0.29
165	0.29
166	0.29
167	0.27
168	0.27
169	0.31
170	0.33
171	0.31
172	0.27
173	0.25
174	0.25
175	0.24
176	0.22
177	0.16
178	0.1
179	0.09
180	0.08
181	0.08
182	0.07
183	0.06
184	0.06
185	0.06
186	0.07
187	0.08
188	0.09
189	0.09
190	0.09
191	0.1
192	0.1
193	0.11
194	0.11
195	0.14
196	0.17
197	0.23
198	0.28
199	0.32
200	0.32
201	0.36
202	0.36
203	0.35
204	0.34
205	0.28
206	0.24
207	0.25
208	0.24
209	0.19
210	0.17
211	0.15
212	0.12
213	0.11
214	0.1
215	0.04
216	0.04
217	0.03
218	0.04
219	0.04
220	0.04
221	0.09
222	0.12
223	0.13
224	0.14
225	0.18
226	0.18
227	0.2
228	0.22
229	0.21
230	0.21
231	0.21
232	0.2
233	0.16
234	0.15
235	0.13
236	0.1
237	0.07
238	0.03
239	0.03
240	0.03
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.04
248	0.06
249	0.06
250	0.06
251	0.06
252	0.08
253	0.08
254	0.08
255	0.08
256	0.07
257	0.08
258	0.08
259	0.13
260	0.15
261	0.15
262	0.15
263	0.16
264	0.18
265	0.19
266	0.19
267	0.15
268	0.12
269	0.12
270	0.11
271	0.1
272	0.09
273	0.08
274	0.07
275	0.07
276	0.06
277	0.06
278	0.06
279	0.05
280	0.05
281	0.04
282	0.03
283	0.04
284	0.04
285	0.04
286	0.06
287	0.07
288	0.07
289	0.07
290	0.08
291	0.08
292	0.08
293	0.1
294	0.08
295	0.11
296	0.13
297	0.14
298	0.13
299	0.14
300	0.14
301	0.14
302	0.14
303	0.13
304	0.12
305	0.11
306	0.12
307	0.13
308	0.17
309	0.18
310	0.2
311	0.25
312	0.28
313	0.3
314	0.3
315	0.28
316	0.28
317	0.29
318	0.27
319	0.22
320	0.22
321	0.19
322	0.19
323	0.18
324	0.14
325	0.1
326	0.1
327	0.08
328	0.04
329	0.05
330	0.06
331	0.06
332	0.06
333	0.07
334	0.09
335	0.1
336	0.1
337	0.11
338	0.11
339	0.14
340	0.19
341	0.21
342	0.21
343	0.21
344	0.21
345	0.22
346	0.29
347	0.29
348	0.31
349	0.37
350	0.41
351	0.44
352	0.51
353	0.51
354	0.44
355	0.46
356	0.42
357	0.34
358	0.29
359	0.25
360	0.18
361	0.17
362	0.16
363	0.1
364	0.08
365	0.06
366	0.06
367	0.06
368	0.06
369	0.06
370	0.06
371	0.07
372	0.1
373	0.12
374	0.19
375	0.2
376	0.25
377	0.26
378	0.26
379	0.27
380	0.31
381	0.3
382	0.24
383	0.29
384	0.25
385	0.24
386	0.25
387	0.27
388	0.24
389	0.31
390	0.31
391	0.26
392	0.27
393	0.26
394	0.25
395	0.22
396	0.21
397	0.16
398	0.18
399	0.19
400	0.2
401	0.21
402	0.22
403	0.23
404	0.3
405	0.32
406	0.33
407	0.35
408	0.45
409	0.54
410	0.65
411	0.73
412	0.76
413	0.81
414	0.84
415	0.88
416	0.84
417	0.83
418	0.8
419	0.76
420	0.66
421	0.58
422	0.53
423	0.44
424	0.37
425	0.28
426	0.2
427	0.12
428	0.1
429	0.08
430	0.05
431	0.05
432	0.05
433	0.05
434	0.05
435	0.05
436	0.05
437	0.05
438	0.06
439	0.06
440	0.07
441	0.06
442	0.06
443	0.07
444	0.07
445	0.07
446	0.1
447	0.12
448	0.16
449	0.23
450	0.24
451	0.27
452	0.36
453	0.43
454	0.49
455	0.56
456	0.61
457	0.66
458	0.76
459	0.81
460	0.81
461	0.81
462	0.78
463	0.73
464	0.72
465	0.66
466	0.63
467	0.6
468	0.55
469	0.55
470	0.55
471	0.56
472	0.49
473	0.47
474	0.43
475	0.42
476	0.43
477	0.43
478	0.44
479	0.43
480	0.47
481	0.5
482	0.54
483	0.55
484	0.6
485	0.58
486	0.53
487	0.57
488	0.56
489	0.56
490	0.55
491	0.59
492	0.6
493	0.64
494	0.69
495	0.72
496	0.77
497	0.77
498	0.78
499	0.76
500	0.74
501	0.73
502	0.72
503	0.7
504	0.68
505	0.72
506	0.74
507	0.74
508	0.76
509	0.79
510	0.74
511	0.76
512	0.76
513	0.74
514	0.76
515	0.8
516	0.8
517	0.79
518	0.8
519	0.77
520	0.75
521	0.68
522	0.6
523	0.54
524	0.46
525	0.39
526	0.36
527	0.31
528	0.25
529	0.23
530	0.2
531	0.15
532	0.14
533	0.13
534	0.15
535	0.18
536	0.23
537	0.3
538	0.36
539	0.41
540	0.49
541	0.56
542	0.63
543	0.69
544	0.73
545	0.69
546	0.75
547	0.81
548	0.82
549	0.85
550	0.83
551	0.8
552	0.73
553	0.78
554	0.77
555	0.73
556	0.72
557	0.7
558	0.72

A0A507EDV5

3D AlphaFold-predicted Structure Viewer