Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CY82

Protein Details
Accession A0A507CY82   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-46EDEDVKPKTKKAKKGQPKSKTPKASTSEHydrophilic
NLS Segment(s)
PositionSequence
24-41KPKTKKAKKGQPKSKTPK
Subcellular Location(s) cyto 13.5, cyto_nucl 10, mito 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MPPKRRAATKAEAGLVESEDEDVKPKTKKAKKGQPKSKTPKASTSEEVPLEVPAAAAVAAVKGNVEAAPATQGETAGPGEKGNIIIESCNTCSTYKSKGNKLAKLLMGTFPNANVAINPSKPRPKSFDVIVNGKNVWSGFTKGPPRTEKFPDDETIVTLVKEAYLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.32
3 0.24
4 0.16
5 0.12
6 0.1
7 0.1
8 0.11
9 0.12
10 0.16
11 0.19
12 0.23
13 0.33
14 0.4
15 0.51
16 0.59
17 0.68
18 0.75
19 0.83
20 0.9
21 0.89
22 0.92
23 0.92
24 0.91
25 0.9
26 0.83
27 0.81
28 0.75
29 0.71
30 0.63
31 0.57
32 0.53
33 0.43
34 0.4
35 0.31
36 0.25
37 0.2
38 0.16
39 0.11
40 0.06
41 0.05
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.03
54 0.03
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.07
63 0.06
64 0.06
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.08
76 0.08
77 0.09
78 0.09
79 0.11
80 0.13
81 0.19
82 0.26
83 0.3
84 0.36
85 0.44
86 0.51
87 0.53
88 0.55
89 0.53
90 0.47
91 0.43
92 0.38
93 0.31
94 0.25
95 0.22
96 0.19
97 0.14
98 0.13
99 0.12
100 0.1
101 0.08
102 0.11
103 0.12
104 0.15
105 0.18
106 0.22
107 0.3
108 0.32
109 0.36
110 0.39
111 0.42
112 0.44
113 0.45
114 0.48
115 0.46
116 0.51
117 0.49
118 0.44
119 0.39
120 0.35
121 0.32
122 0.23
123 0.2
124 0.15
125 0.17
126 0.16
127 0.24
128 0.32
129 0.34
130 0.42
131 0.48
132 0.51
133 0.54
134 0.59
135 0.57
136 0.54
137 0.55
138 0.51
139 0.47
140 0.42
141 0.37
142 0.33
143 0.27
144 0.22
145 0.18
146 0.15
147 0.11