Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507BN52

Protein Details
Accession A0A507BN52   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-115GYGGCGRFKKHGRRCGRGHKFGIQBasic
NLS Segment(s)
Subcellular Location(s) cyto 2, cyto_pero 2, extr 16, mito 3, mito_nucl 2, pero 2, plas 2
Family & Domain DBs
Amino Acid Sequences MRLIDAMCVVSALLVVIIKAAAAWVQKTSHDIQDPNTSIQAPAAPQSEREPTYTRMDAGGGDHVEDDLFTTKGRSRGYGGGYAGCGREYHGGYGGCGRFKKHGRRCGRGHKFGIQERY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.04
5 0.03
6 0.03
7 0.03
8 0.05
9 0.06
10 0.07
11 0.08
12 0.09
13 0.1
14 0.14
15 0.17
16 0.2
17 0.22
18 0.23
19 0.24
20 0.32
21 0.34
22 0.31
23 0.29
24 0.25
25 0.22
26 0.21
27 0.19
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.14
34 0.18
35 0.18
36 0.2
37 0.21
38 0.22
39 0.27
40 0.26
41 0.24
42 0.2
43 0.19
44 0.17
45 0.14
46 0.13
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.06
54 0.05
55 0.05
56 0.05
57 0.07
58 0.09
59 0.14
60 0.15
61 0.15
62 0.17
63 0.21
64 0.24
65 0.26
66 0.24
67 0.21
68 0.21
69 0.21
70 0.18
71 0.14
72 0.12
73 0.1
74 0.13
75 0.13
76 0.13
77 0.17
78 0.17
79 0.17
80 0.24
81 0.24
82 0.24
83 0.25
84 0.26
85 0.29
86 0.38
87 0.49
88 0.52
89 0.6
90 0.65
91 0.73
92 0.81
93 0.84
94 0.86
95 0.85
96 0.81
97 0.79
98 0.78