Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DK85

Protein Details
Accession A0A507DK85   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-130RPTYLKPPSKNKNTPMKRKADEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, cyto_nucl 14, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010095  Transposase_IS605_OrfB_C  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0032196  P:transposition  
Pfam View protein in Pfam  
PF07282  OrfB_Zn_ribbon  
Amino Acid Sequences MVGESMGHKLSGGKQVIVAIGMGDFSSNKSRHVMFIRYLIRKLRPLGYTIVGVNEYYTSKKCPCCMEFVEMPAMRRLYCRRCNKWYHRDVMAADNMVNIVRGYLEHDERPTYLKPPSKNKNTPMKRKADEGGGLKTREKVAYGPVGYVDYKTYEEEHGITERAIVPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.22
5 0.17
6 0.09
7 0.07
8 0.07
9 0.06
10 0.05
11 0.05
12 0.07
13 0.15
14 0.15
15 0.17
16 0.2
17 0.21
18 0.26
19 0.31
20 0.32
21 0.27
22 0.35
23 0.42
24 0.42
25 0.44
26 0.44
27 0.43
28 0.43
29 0.44
30 0.41
31 0.35
32 0.33
33 0.33
34 0.3
35 0.28
36 0.24
37 0.22
38 0.16
39 0.15
40 0.13
41 0.1
42 0.1
43 0.1
44 0.11
45 0.13
46 0.17
47 0.2
48 0.22
49 0.27
50 0.28
51 0.31
52 0.33
53 0.35
54 0.32
55 0.31
56 0.35
57 0.29
58 0.29
59 0.25
60 0.23
61 0.18
62 0.19
63 0.23
64 0.25
65 0.34
66 0.42
67 0.47
68 0.53
69 0.63
70 0.7
71 0.75
72 0.72
73 0.68
74 0.61
75 0.56
76 0.51
77 0.44
78 0.35
79 0.26
80 0.2
81 0.15
82 0.12
83 0.1
84 0.09
85 0.05
86 0.04
87 0.03
88 0.03
89 0.06
90 0.09
91 0.11
92 0.12
93 0.13
94 0.14
95 0.15
96 0.18
97 0.17
98 0.17
99 0.21
100 0.25
101 0.31
102 0.4
103 0.49
104 0.56
105 0.63
106 0.69
107 0.74
108 0.78
109 0.83
110 0.82
111 0.82
112 0.74
113 0.71
114 0.65
115 0.59
116 0.55
117 0.48
118 0.47
119 0.42
120 0.42
121 0.38
122 0.38
123 0.35
124 0.29
125 0.27
126 0.2
127 0.2
128 0.26
129 0.25
130 0.23
131 0.22
132 0.24
133 0.23
134 0.22
135 0.19
136 0.13
137 0.14
138 0.15
139 0.16
140 0.16
141 0.17
142 0.17
143 0.19
144 0.19
145 0.19
146 0.17
147 0.18
148 0.2