Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507D129

Protein Details
Accession A0A507D129    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-88GFSRCMPKKMMTRQKKSNSVFRIHydrophilic
639-658IRFYKRCKKIFQSIISRNADHydrophilic
NLS Segment(s)
PositionSequence
483-503KRRGPSAIGSLSGKAPKRNRK
Subcellular Location(s) nucl 16.5, cyto_nucl 14.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015655  PP2C  
IPR036457  PPM-type-like_dom_sf  
IPR001932  PPM-type_phosphatase-like_dom  
Gene Ontology GO:0004722  F:protein serine/threonine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF00481  PP2C  
Amino Acid Sequences MDYSSLPAQSAKACADDEINPDLVGESLQRFGTLPEIQVETPSPELRQGATATDSLFSLLRAPFSGFSRCMPKKMMTRQKKSNSVFRIEYACKGAGVNAASKEDRVIVIEDYEAFVRDGYASYDVRKYGDAKPSPPPANSFKIPPSVGSNPEQTPVDKFKLFAVFDGHCGAIASSFLQYRFPYELSGTPEFHTGDYSQALTSAFQRAHTALLECKSYAPEAPNNDFSSGCTASVVLVTPTTTYFAMVGDSPIMIWKQRDIYPDLLFKEHDADNPSIFPHIVASNMFLVMVREVDMHNTYYIVTSEKMRAKLLHLAAASSAGEGGTSTHNSNNSAAAGPPSSKPKGILKSERADDQGEITTPIEQSDDTAVVLDGSQHPQAEGVDGILEVKDDPAKAPAPVNPPEFSAIPGADDDADVQFDDLRIGMSALNVFGTLGDSFYDPAVFNTFIDELVAFRQDRVWRYNAHIEKVKSDPSDLTDSVRKRRGPSAIGSLSGKAPKRNRKESLEITTEATANSDARSGSPIAVIPKNNEDSIFAPQLKFAFEKMHSLSDLEGVNPLEFPYSELREWLLVRPNWAFLSKHLSLLKKESQMSRVLLSAVIGLDHRHRLNSPGLVRVPEVAAIPNHELRSFVIASDGVIRFYKRCKKIFQSIISRNADTPEKCVEEMMSNLKWLKDDRSIIVCRFGVKSQLAQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.22
4 0.24
5 0.24
6 0.24
7 0.21
8 0.2
9 0.2
10 0.17
11 0.14
12 0.12
13 0.1
14 0.12
15 0.12
16 0.12
17 0.12
18 0.13
19 0.18
20 0.17
21 0.17
22 0.18
23 0.21
24 0.21
25 0.22
26 0.23
27 0.21
28 0.22
29 0.23
30 0.2
31 0.2
32 0.22
33 0.21
34 0.22
35 0.2
36 0.19
37 0.2
38 0.2
39 0.18
40 0.17
41 0.16
42 0.14
43 0.13
44 0.11
45 0.13
46 0.12
47 0.13
48 0.13
49 0.15
50 0.17
51 0.2
52 0.25
53 0.22
54 0.25
55 0.34
56 0.36
57 0.38
58 0.39
59 0.43
60 0.48
61 0.57
62 0.65
63 0.65
64 0.73
65 0.8
66 0.85
67 0.88
68 0.85
69 0.83
70 0.79
71 0.75
72 0.68
73 0.61
74 0.59
75 0.51
76 0.48
77 0.43
78 0.36
79 0.29
80 0.27
81 0.25
82 0.21
83 0.2
84 0.2
85 0.18
86 0.21
87 0.21
88 0.21
89 0.2
90 0.18
91 0.16
92 0.14
93 0.14
94 0.12
95 0.12
96 0.12
97 0.12
98 0.12
99 0.12
100 0.11
101 0.09
102 0.08
103 0.08
104 0.08
105 0.08
106 0.09
107 0.12
108 0.12
109 0.15
110 0.18
111 0.18
112 0.19
113 0.2
114 0.22
115 0.25
116 0.34
117 0.35
118 0.36
119 0.43
120 0.5
121 0.52
122 0.5
123 0.48
124 0.45
125 0.48
126 0.46
127 0.43
128 0.38
129 0.4
130 0.39
131 0.35
132 0.36
133 0.33
134 0.35
135 0.34
136 0.35
137 0.3
138 0.33
139 0.32
140 0.26
141 0.27
142 0.29
143 0.3
144 0.26
145 0.26
146 0.27
147 0.32
148 0.31
149 0.27
150 0.26
151 0.22
152 0.23
153 0.25
154 0.21
155 0.14
156 0.14
157 0.13
158 0.08
159 0.08
160 0.07
161 0.07
162 0.08
163 0.09
164 0.11
165 0.11
166 0.14
167 0.17
168 0.16
169 0.16
170 0.17
171 0.2
172 0.24
173 0.27
174 0.25
175 0.24
176 0.26
177 0.25
178 0.23
179 0.21
180 0.15
181 0.14
182 0.13
183 0.13
184 0.11
185 0.11
186 0.11
187 0.1
188 0.11
189 0.13
190 0.12
191 0.12
192 0.14
193 0.14
194 0.15
195 0.15
196 0.15
197 0.14
198 0.16
199 0.16
200 0.15
201 0.15
202 0.15
203 0.14
204 0.15
205 0.15
206 0.18
207 0.22
208 0.26
209 0.3
210 0.3
211 0.3
212 0.28
213 0.26
214 0.27
215 0.22
216 0.18
217 0.13
218 0.12
219 0.11
220 0.11
221 0.11
222 0.06
223 0.05
224 0.05
225 0.06
226 0.06
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.07
233 0.07
234 0.07
235 0.06
236 0.06
237 0.05
238 0.06
239 0.06
240 0.07
241 0.07
242 0.08
243 0.12
244 0.15
245 0.18
246 0.2
247 0.24
248 0.25
249 0.29
250 0.29
251 0.26
252 0.24
253 0.21
254 0.22
255 0.18
256 0.18
257 0.17
258 0.17
259 0.16
260 0.16
261 0.16
262 0.13
263 0.12
264 0.1
265 0.08
266 0.07
267 0.07
268 0.07
269 0.08
270 0.08
271 0.08
272 0.08
273 0.06
274 0.06
275 0.06
276 0.06
277 0.05
278 0.05
279 0.05
280 0.07
281 0.08
282 0.08
283 0.08
284 0.08
285 0.08
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.14
292 0.18
293 0.19
294 0.2
295 0.2
296 0.21
297 0.26
298 0.26
299 0.23
300 0.2
301 0.18
302 0.17
303 0.17
304 0.15
305 0.08
306 0.07
307 0.04
308 0.03
309 0.03
310 0.04
311 0.05
312 0.06
313 0.07
314 0.09
315 0.1
316 0.11
317 0.11
318 0.11
319 0.11
320 0.1
321 0.09
322 0.09
323 0.08
324 0.08
325 0.1
326 0.14
327 0.14
328 0.14
329 0.16
330 0.21
331 0.27
332 0.32
333 0.38
334 0.38
335 0.42
336 0.43
337 0.43
338 0.39
339 0.33
340 0.27
341 0.22
342 0.17
343 0.12
344 0.12
345 0.1
346 0.09
347 0.08
348 0.08
349 0.07
350 0.06
351 0.06
352 0.06
353 0.06
354 0.05
355 0.06
356 0.05
357 0.05
358 0.05
359 0.05
360 0.05
361 0.07
362 0.08
363 0.07
364 0.07
365 0.08
366 0.08
367 0.08
368 0.07
369 0.05
370 0.04
371 0.04
372 0.04
373 0.04
374 0.04
375 0.03
376 0.04
377 0.05
378 0.05
379 0.05
380 0.07
381 0.08
382 0.09
383 0.1
384 0.14
385 0.18
386 0.23
387 0.25
388 0.23
389 0.23
390 0.25
391 0.24
392 0.21
393 0.17
394 0.12
395 0.1
396 0.1
397 0.09
398 0.07
399 0.07
400 0.06
401 0.05
402 0.05
403 0.05
404 0.05
405 0.05
406 0.04
407 0.05
408 0.04
409 0.04
410 0.04
411 0.04
412 0.04
413 0.05
414 0.05
415 0.05
416 0.05
417 0.04
418 0.04
419 0.04
420 0.05
421 0.04
422 0.04
423 0.05
424 0.05
425 0.06
426 0.06
427 0.07
428 0.06
429 0.07
430 0.09
431 0.09
432 0.08
433 0.1
434 0.1
435 0.09
436 0.09
437 0.09
438 0.06
439 0.07
440 0.1
441 0.08
442 0.08
443 0.12
444 0.15
445 0.19
446 0.22
447 0.24
448 0.23
449 0.28
450 0.38
451 0.37
452 0.38
453 0.41
454 0.38
455 0.39
456 0.4
457 0.39
458 0.3
459 0.29
460 0.25
461 0.23
462 0.27
463 0.24
464 0.25
465 0.27
466 0.3
467 0.36
468 0.42
469 0.4
470 0.38
471 0.44
472 0.45
473 0.42
474 0.43
475 0.45
476 0.4
477 0.39
478 0.37
479 0.32
480 0.3
481 0.31
482 0.29
483 0.27
484 0.34
485 0.42
486 0.5
487 0.59
488 0.63
489 0.65
490 0.72
491 0.72
492 0.71
493 0.66
494 0.58
495 0.51
496 0.45
497 0.38
498 0.29
499 0.23
500 0.16
501 0.12
502 0.1
503 0.09
504 0.08
505 0.08
506 0.11
507 0.11
508 0.1
509 0.1
510 0.12
511 0.15
512 0.19
513 0.2
514 0.21
515 0.25
516 0.27
517 0.27
518 0.25
519 0.23
520 0.21
521 0.25
522 0.28
523 0.24
524 0.21
525 0.22
526 0.23
527 0.22
528 0.21
529 0.17
530 0.17
531 0.17
532 0.22
533 0.23
534 0.25
535 0.23
536 0.23
537 0.23
538 0.2
539 0.2
540 0.14
541 0.15
542 0.13
543 0.12
544 0.12
545 0.12
546 0.09
547 0.09
548 0.11
549 0.13
550 0.17
551 0.17
552 0.17
553 0.18
554 0.2
555 0.21
556 0.23
557 0.27
558 0.24
559 0.28
560 0.28
561 0.29
562 0.28
563 0.3
564 0.26
565 0.2
566 0.28
567 0.25
568 0.3
569 0.32
570 0.34
571 0.34
572 0.4
573 0.45
574 0.42
575 0.46
576 0.44
577 0.43
578 0.45
579 0.44
580 0.38
581 0.33
582 0.27
583 0.23
584 0.19
585 0.17
586 0.11
587 0.1
588 0.08
589 0.09
590 0.12
591 0.17
592 0.18
593 0.19
594 0.2
595 0.23
596 0.28
597 0.34
598 0.33
599 0.35
600 0.37
601 0.36
602 0.36
603 0.34
604 0.29
605 0.23
606 0.21
607 0.16
608 0.15
609 0.17
610 0.2
611 0.23
612 0.23
613 0.22
614 0.22
615 0.21
616 0.25
617 0.22
618 0.18
619 0.16
620 0.14
621 0.15
622 0.21
623 0.2
624 0.17
625 0.18
626 0.2
627 0.2
628 0.3
629 0.39
630 0.41
631 0.47
632 0.54
633 0.61
634 0.7
635 0.77
636 0.78
637 0.78
638 0.78
639 0.82
640 0.78
641 0.72
642 0.62
643 0.56
644 0.54
645 0.44
646 0.39
647 0.36
648 0.34
649 0.32
650 0.32
651 0.3
652 0.25
653 0.29
654 0.31
655 0.25
656 0.26
657 0.27
658 0.27
659 0.28
660 0.28
661 0.3
662 0.31
663 0.34
664 0.36
665 0.42
666 0.46
667 0.45
668 0.49
669 0.45
670 0.4
671 0.39
672 0.36
673 0.34
674 0.31