Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CGV8

Protein Details
Accession A0A507CGV8   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-98IFKNDRRTERPGPKQYKRKRWDADBasic
129-150RPAYLKSPSKNRNTPMKRKADEHydrophilic
NLS Segment(s)
PositionSequence
87-93PKQYKRK
Subcellular Location(s) mito 4, nucl 22
Family & Domain DBs
Amino Acid Sequences MKNPSKGRLLDEVFLLPPEMLAKGRYMLDNSQRRYVRTSSFKTNGPVLPLLWIDTTSQPPPTARKVEDAINLPNIFKNDRRTERPGPKQYKRKRWDADETKHGELDKVLEGIVNMVGESMGSHLERDERPAYLKSPSKNRNTPMKRKADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.15
4 0.11
5 0.11
6 0.1
7 0.09
8 0.09
9 0.1
10 0.11
11 0.13
12 0.14
13 0.16
14 0.2
15 0.3
16 0.37
17 0.4
18 0.46
19 0.47
20 0.47
21 0.49
22 0.47
23 0.45
24 0.46
25 0.47
26 0.48
27 0.49
28 0.51
29 0.49
30 0.5
31 0.42
32 0.37
33 0.32
34 0.23
35 0.21
36 0.19
37 0.17
38 0.12
39 0.12
40 0.1
41 0.11
42 0.14
43 0.13
44 0.14
45 0.13
46 0.15
47 0.18
48 0.21
49 0.24
50 0.22
51 0.24
52 0.25
53 0.27
54 0.29
55 0.28
56 0.25
57 0.24
58 0.23
59 0.2
60 0.19
61 0.17
62 0.15
63 0.16
64 0.2
65 0.25
66 0.3
67 0.35
68 0.41
69 0.5
70 0.58
71 0.66
72 0.7
73 0.72
74 0.76
75 0.81
76 0.83
77 0.85
78 0.81
79 0.81
80 0.77
81 0.75
82 0.77
83 0.76
84 0.73
85 0.71
86 0.71
87 0.62
88 0.57
89 0.5
90 0.39
91 0.29
92 0.25
93 0.16
94 0.11
95 0.1
96 0.08
97 0.08
98 0.08
99 0.08
100 0.06
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.07
111 0.11
112 0.12
113 0.17
114 0.18
115 0.18
116 0.22
117 0.24
118 0.26
119 0.3
120 0.35
121 0.37
122 0.46
123 0.54
124 0.6
125 0.66
126 0.71
127 0.74
128 0.78
129 0.82
130 0.82