Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DDY3

Protein Details
Accession A0A507DDY3    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-133ESYWQNRPSNFKSNRRRRQNGLALGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 12.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000477  RT_dom  
Pfam View protein in Pfam  
PF00078  RVT_1  
Amino Acid Sequences MMRSRKCSSSSSPKEGSNWNHRIDYVLHRLDLDPEKNAWHKPSPYGTCLNAIGIRGKCLRIIESLYNSASLRAKVGDHLSKEVKIEKGVRQGDPLSTALFDIFINDFESYWQNRPSNFKSNRRRRQNGLALGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.6
4 0.59
5 0.56
6 0.52
7 0.49
8 0.46
9 0.45
10 0.4
11 0.39
12 0.37
13 0.33
14 0.3
15 0.29
16 0.3
17 0.32
18 0.34
19 0.28
20 0.22
21 0.21
22 0.24
23 0.26
24 0.28
25 0.27
26 0.27
27 0.27
28 0.29
29 0.37
30 0.36
31 0.37
32 0.39
33 0.36
34 0.33
35 0.31
36 0.28
37 0.21
38 0.18
39 0.2
40 0.16
41 0.18
42 0.16
43 0.16
44 0.16
45 0.16
46 0.17
47 0.13
48 0.16
49 0.15
50 0.16
51 0.18
52 0.16
53 0.17
54 0.16
55 0.16
56 0.14
57 0.12
58 0.1
59 0.09
60 0.09
61 0.09
62 0.14
63 0.16
64 0.16
65 0.2
66 0.21
67 0.21
68 0.22
69 0.23
70 0.2
71 0.2
72 0.22
73 0.22
74 0.29
75 0.32
76 0.31
77 0.31
78 0.31
79 0.29
80 0.28
81 0.25
82 0.16
83 0.13
84 0.13
85 0.1
86 0.1
87 0.09
88 0.08
89 0.07
90 0.08
91 0.09
92 0.09
93 0.09
94 0.1
95 0.15
96 0.17
97 0.2
98 0.26
99 0.26
100 0.29
101 0.37
102 0.42
103 0.49
104 0.55
105 0.62
106 0.67
107 0.76
108 0.84
109 0.87
110 0.88
111 0.85
112 0.87
113 0.87