Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507DA92

Protein Details
Accession A0A507DA92    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
80-107GKSIERAKKLKKAMKKKKKENASGAISGHydrophilic
NLS Segment(s)
PositionSequence
77-99AKEGKSIERAKKLKKAMKKKKKE
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGLVKQKASSAGQASQRRKAAPVATASKVSCKAQVKNKQKELQRKLNASVVAKAEVQLAARVTAANKLTVLRSHAKEGKSIERAKKLKKAMKKKKKENASGAISGGGSTAAAAAASKDSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.5
4 0.52
5 0.54
6 0.5
7 0.48
8 0.47
9 0.41
10 0.36
11 0.39
12 0.37
13 0.35
14 0.37
15 0.36
16 0.35
17 0.34
18 0.31
19 0.3
20 0.3
21 0.34
22 0.41
23 0.51
24 0.58
25 0.65
26 0.73
27 0.72
28 0.75
29 0.79
30 0.78
31 0.78
32 0.75
33 0.68
34 0.62
35 0.6
36 0.56
37 0.46
38 0.4
39 0.3
40 0.25
41 0.21
42 0.18
43 0.14
44 0.12
45 0.11
46 0.09
47 0.08
48 0.06
49 0.06
50 0.06
51 0.06
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.1
58 0.1
59 0.14
60 0.17
61 0.18
62 0.23
63 0.28
64 0.28
65 0.3
66 0.33
67 0.36
68 0.38
69 0.43
70 0.43
71 0.48
72 0.54
73 0.57
74 0.61
75 0.63
76 0.64
77 0.67
78 0.73
79 0.75
80 0.8
81 0.85
82 0.88
83 0.89
84 0.92
85 0.91
86 0.89
87 0.86
88 0.81
89 0.72
90 0.62
91 0.53
92 0.43
93 0.33
94 0.24
95 0.14
96 0.08
97 0.05
98 0.05
99 0.03
100 0.03
101 0.04
102 0.04
103 0.08