Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507DCK4

Protein Details
Accession A0A507DCK4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
234-258KSGPAAHRPKPKSARPSKKPVKKAEBasic
NLS Segment(s)
PositionSequence
236-258GPAAHRPKPKSARPSKKPVKKAE
Subcellular Location(s) plas 9, E.R. 9, extr 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016817  MannP-dilichol_defect-1  
IPR006603  PQ-loop_rpt  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04193  PQ-loop  
Amino Acid Sequences MEVAKQIIRPPLLRLVGPRCTDSLLSFDLHDALCLKLLISKVLSLGIVTFGSILKVPQISKIVGSGSVTGISATSYLLETLVYLVALAYNHRQGNAFSTYGEVAFITLQNFIVLLLLFTYSRQVMLLLAVAGALSATTYGLFDPSLVDSTLLSRFQWATIFLSAASKLPQIYSNYKNASTGQLSAITVLLTLAGSAARVFTTWHEVNDPALLTAFVVATLLNLVLGIQVMLYPKSGPAAHRPKPKSARPSKKPVKKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.44
4 0.45
5 0.43
6 0.36
7 0.36
8 0.36
9 0.3
10 0.27
11 0.21
12 0.2
13 0.18
14 0.17
15 0.17
16 0.15
17 0.15
18 0.12
19 0.11
20 0.11
21 0.1
22 0.1
23 0.1
24 0.11
25 0.12
26 0.12
27 0.12
28 0.11
29 0.12
30 0.12
31 0.09
32 0.09
33 0.08
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.1
43 0.1
44 0.13
45 0.16
46 0.16
47 0.16
48 0.17
49 0.16
50 0.14
51 0.15
52 0.12
53 0.1
54 0.1
55 0.09
56 0.08
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.04
66 0.04
67 0.05
68 0.05
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.05
75 0.07
76 0.11
77 0.12
78 0.12
79 0.13
80 0.13
81 0.17
82 0.18
83 0.17
84 0.12
85 0.14
86 0.13
87 0.13
88 0.13
89 0.08
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.04
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.05
107 0.04
108 0.05
109 0.05
110 0.05
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.09
138 0.09
139 0.08
140 0.09
141 0.09
142 0.09
143 0.1
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.1
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.08
156 0.12
157 0.15
158 0.21
159 0.24
160 0.29
161 0.31
162 0.32
163 0.32
164 0.3
165 0.29
166 0.25
167 0.22
168 0.17
169 0.16
170 0.16
171 0.15
172 0.14
173 0.1
174 0.08
175 0.07
176 0.05
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.05
187 0.06
188 0.14
189 0.15
190 0.16
191 0.18
192 0.19
193 0.19
194 0.21
195 0.19
196 0.12
197 0.11
198 0.1
199 0.08
200 0.08
201 0.07
202 0.05
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.03
214 0.03
215 0.04
216 0.06
217 0.06
218 0.07
219 0.07
220 0.08
221 0.12
222 0.13
223 0.15
224 0.24
225 0.34
226 0.42
227 0.53
228 0.57
229 0.64
230 0.72
231 0.78
232 0.79
233 0.8
234 0.83
235 0.81
236 0.89
237 0.89
238 0.9