Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DKB2

Protein Details
Accession A0A507DKB2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-73NLYCKYTKSIDRKRKKSSKEIKAKKRNPVIPYHydrophilic
NLS Segment(s)
PositionSequence
53-67RKRKKSSKEIKAKKR
Subcellular Location(s) cyto_mito 9, mito 18, nucl 9
Family & Domain DBs
Amino Acid Sequences MSLISLDHTSICWKSRHRTVYRLEKHLGIYITELEKTAIINNLYCKYTKSIDRKRKKSSKEIKAKKRNPVIPYYIVQGLPMISATTSCIARIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.51
4 0.52
5 0.57
6 0.63
7 0.69
8 0.72
9 0.7
10 0.64
11 0.56
12 0.53
13 0.49
14 0.4
15 0.29
16 0.22
17 0.18
18 0.17
19 0.15
20 0.14
21 0.1
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.12
29 0.13
30 0.14
31 0.14
32 0.14
33 0.14
34 0.17
35 0.23
36 0.31
37 0.4
38 0.5
39 0.6
40 0.68
41 0.76
42 0.82
43 0.81
44 0.82
45 0.82
46 0.82
47 0.83
48 0.85
49 0.86
50 0.88
51 0.89
52 0.88
53 0.87
54 0.83
55 0.76
56 0.72
57 0.67
58 0.6
59 0.54
60 0.49
61 0.42
62 0.34
63 0.3
64 0.24
65 0.18
66 0.13
67 0.12
68 0.08
69 0.06
70 0.06
71 0.08
72 0.1
73 0.1