Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507CS18

Protein Details
Accession A0A507CS18    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
320-339MDRRPPYDRERDPKRRRMEEBasic
NLS Segment(s)
PositionSequence
286-343RAGPLPPPPARNDWRPHPPGRDDFRPRGGGRGGFMDRRPPYDRERDPKRRRMEEPPPP
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MKNGRLHPEQSQPASPYPSSGPAANPQDASAAAAAAAAAAAYQQYQQQYYQQYQQQMYAASGYYPVGAAGQPSAAATAAAYPVAGPTYPGQPVYPQTTPQAPPHSYGVASYAGQPLAQYPPYNAAAAPAPATPTVSAAPVDKRRAPRGPAASVPPSDYHPRLPSSYRSPRPNDSPRFHNRPPPPVGAPNGVYYPPPVGPDMMPDVSRYSTDGRGMPPPPMGMPPPDYHHGSPYRGGMRNGPRGMSDRGRGPSYRPDHRFAPRGFRPGPPGPHDDFRPYGPGGYDRRAGPLPPPPARNDWRPHPPGRDDFRPRGGGRGGFMDRRPPYDRERDPKRRRMEEPPPPARDAKSQTAPPPAANVTSTDPAPPGVTEPTREGIKAPPPAFPPPSIAATAASSTKATDAPTTSSTSVSSPPPSASGKVLVADYALGKLCIGSSAAIDASERISGDVDVDMQYNESNEFRVEDVVKGIPIGAFFNQHILHDPWEELERSSVEHPAGFNPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.41
4 0.36
5 0.36
6 0.33
7 0.31
8 0.29
9 0.32
10 0.38
11 0.37
12 0.35
13 0.3
14 0.29
15 0.27
16 0.26
17 0.17
18 0.11
19 0.08
20 0.08
21 0.07
22 0.05
23 0.05
24 0.03
25 0.02
26 0.03
27 0.03
28 0.04
29 0.05
30 0.08
31 0.11
32 0.13
33 0.15
34 0.21
35 0.26
36 0.3
37 0.37
38 0.39
39 0.44
40 0.44
41 0.45
42 0.41
43 0.36
44 0.32
45 0.26
46 0.21
47 0.14
48 0.14
49 0.12
50 0.09
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.08
74 0.12
75 0.13
76 0.14
77 0.14
78 0.16
79 0.2
80 0.26
81 0.25
82 0.24
83 0.26
84 0.32
85 0.34
86 0.38
87 0.41
88 0.36
89 0.37
90 0.38
91 0.36
92 0.3
93 0.27
94 0.24
95 0.18
96 0.17
97 0.16
98 0.15
99 0.13
100 0.13
101 0.13
102 0.12
103 0.14
104 0.15
105 0.14
106 0.13
107 0.17
108 0.19
109 0.19
110 0.17
111 0.15
112 0.15
113 0.15
114 0.15
115 0.11
116 0.1
117 0.1
118 0.11
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.11
125 0.18
126 0.23
127 0.27
128 0.31
129 0.36
130 0.42
131 0.47
132 0.49
133 0.5
134 0.51
135 0.5
136 0.48
137 0.49
138 0.45
139 0.41
140 0.39
141 0.31
142 0.28
143 0.3
144 0.28
145 0.26
146 0.25
147 0.27
148 0.28
149 0.3
150 0.32
151 0.37
152 0.45
153 0.49
154 0.53
155 0.56
156 0.59
157 0.65
158 0.7
159 0.69
160 0.63
161 0.65
162 0.66
163 0.7
164 0.67
165 0.67
166 0.63
167 0.62
168 0.62
169 0.58
170 0.52
171 0.48
172 0.48
173 0.42
174 0.38
175 0.31
176 0.27
177 0.23
178 0.19
179 0.16
180 0.15
181 0.12
182 0.11
183 0.1
184 0.1
185 0.1
186 0.12
187 0.14
188 0.13
189 0.13
190 0.13
191 0.14
192 0.13
193 0.13
194 0.13
195 0.12
196 0.12
197 0.14
198 0.15
199 0.16
200 0.2
201 0.2
202 0.2
203 0.18
204 0.17
205 0.16
206 0.16
207 0.15
208 0.12
209 0.14
210 0.14
211 0.17
212 0.2
213 0.22
214 0.21
215 0.25
216 0.26
217 0.24
218 0.24
219 0.25
220 0.28
221 0.27
222 0.28
223 0.29
224 0.33
225 0.39
226 0.38
227 0.35
228 0.3
229 0.31
230 0.34
231 0.3
232 0.25
233 0.22
234 0.24
235 0.25
236 0.25
237 0.23
238 0.28
239 0.31
240 0.38
241 0.38
242 0.39
243 0.42
244 0.46
245 0.51
246 0.44
247 0.48
248 0.43
249 0.46
250 0.44
251 0.41
252 0.43
253 0.41
254 0.44
255 0.38
256 0.4
257 0.36
258 0.37
259 0.37
260 0.33
261 0.29
262 0.26
263 0.25
264 0.2
265 0.17
266 0.15
267 0.19
268 0.19
269 0.2
270 0.22
271 0.19
272 0.22
273 0.22
274 0.22
275 0.19
276 0.23
277 0.28
278 0.29
279 0.31
280 0.31
281 0.37
282 0.41
283 0.46
284 0.44
285 0.43
286 0.48
287 0.52
288 0.54
289 0.53
290 0.54
291 0.55
292 0.56
293 0.59
294 0.57
295 0.56
296 0.56
297 0.57
298 0.52
299 0.47
300 0.43
301 0.35
302 0.29
303 0.3
304 0.27
305 0.24
306 0.24
307 0.28
308 0.27
309 0.31
310 0.34
311 0.32
312 0.36
313 0.43
314 0.5
315 0.51
316 0.61
317 0.68
318 0.73
319 0.79
320 0.82
321 0.79
322 0.77
323 0.77
324 0.77
325 0.76
326 0.77
327 0.77
328 0.72
329 0.67
330 0.64
331 0.57
332 0.53
333 0.48
334 0.44
335 0.41
336 0.41
337 0.42
338 0.46
339 0.45
340 0.38
341 0.36
342 0.3
343 0.26
344 0.22
345 0.21
346 0.17
347 0.18
348 0.18
349 0.15
350 0.15
351 0.14
352 0.14
353 0.12
354 0.1
355 0.13
356 0.14
357 0.15
358 0.17
359 0.2
360 0.2
361 0.2
362 0.2
363 0.2
364 0.26
365 0.32
366 0.3
367 0.31
368 0.34
369 0.39
370 0.41
371 0.37
372 0.35
373 0.3
374 0.31
375 0.28
376 0.25
377 0.2
378 0.19
379 0.19
380 0.15
381 0.13
382 0.11
383 0.11
384 0.11
385 0.11
386 0.11
387 0.12
388 0.13
389 0.16
390 0.18
391 0.22
392 0.21
393 0.21
394 0.21
395 0.2
396 0.21
397 0.21
398 0.22
399 0.19
400 0.19
401 0.22
402 0.23
403 0.24
404 0.23
405 0.23
406 0.21
407 0.21
408 0.2
409 0.16
410 0.14
411 0.13
412 0.11
413 0.1
414 0.09
415 0.08
416 0.08
417 0.08
418 0.08
419 0.07
420 0.08
421 0.06
422 0.06
423 0.07
424 0.08
425 0.08
426 0.08
427 0.08
428 0.09
429 0.09
430 0.09
431 0.08
432 0.09
433 0.09
434 0.09
435 0.09
436 0.09
437 0.09
438 0.1
439 0.1
440 0.09
441 0.1
442 0.1
443 0.11
444 0.11
445 0.11
446 0.11
447 0.12
448 0.12
449 0.16
450 0.16
451 0.16
452 0.18
453 0.18
454 0.18
455 0.16
456 0.16
457 0.12
458 0.12
459 0.13
460 0.11
461 0.13
462 0.13
463 0.18
464 0.18
465 0.18
466 0.23
467 0.23
468 0.25
469 0.23
470 0.24
471 0.21
472 0.24
473 0.25
474 0.2
475 0.21
476 0.19
477 0.2
478 0.22
479 0.23
480 0.2
481 0.21
482 0.21