Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DLG3

Protein Details
Accession A0A507DLG3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRRNNGRSKHGRGHTVABasic
87-106VRSREGRRDRTPPQRFRPAABasic
NLS Segment(s)
PositionSequence
4-12KRRNNGRSK
89-116SREGRRDRTPPQRFRPAAKDASKPAPGA
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNNGRSKHGRGHTVAVRCSNCARCVPKDKAIKRFTIRNMVEPAAVNDMRMATVYDEEYALPKLYVKLLYCISCAIHSHVVRVRSREGRRDRTPPQRFRPAAKDASKPAPGAPVAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.73
3 0.7
4 0.65
5 0.6
6 0.55
7 0.52
8 0.47
9 0.43
10 0.46
11 0.42
12 0.37
13 0.38
14 0.39
15 0.39
16 0.46
17 0.5
18 0.53
19 0.59
20 0.63
21 0.66
22 0.65
23 0.66
24 0.62
25 0.63
26 0.59
27 0.59
28 0.54
29 0.49
30 0.48
31 0.42
32 0.38
33 0.31
34 0.28
35 0.22
36 0.21
37 0.16
38 0.12
39 0.11
40 0.1
41 0.1
42 0.09
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.1
57 0.09
58 0.11
59 0.13
60 0.14
61 0.14
62 0.15
63 0.14
64 0.13
65 0.14
66 0.14
67 0.19
68 0.18
69 0.22
70 0.24
71 0.29
72 0.3
73 0.32
74 0.35
75 0.38
76 0.42
77 0.48
78 0.54
79 0.58
80 0.63
81 0.68
82 0.71
83 0.73
84 0.79
85 0.79
86 0.79
87 0.8
88 0.77
89 0.76
90 0.74
91 0.7
92 0.69
93 0.65
94 0.63
95 0.58
96 0.62
97 0.58
98 0.52
99 0.45
100 0.41
101 0.36