Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507CS43

Protein Details
Accession A0A507CS43    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-38IVWKRRFRLTERQKYRHRLRLRABasic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFGAFRGSLVALGGIVWKRRFRLTERQKYRHRLRLRAVDDVVDAIAESGVSIRALDLALKEPKESEMSAAQKYWVYSKRYKGSVKPAHWVPKWTKARFVRSPPGTVMHAPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.15
4 0.18
5 0.2
6 0.23
7 0.27
8 0.31
9 0.34
10 0.43
11 0.5
12 0.58
13 0.66
14 0.73
15 0.78
16 0.84
17 0.87
18 0.86
19 0.82
20 0.79
21 0.76
22 0.77
23 0.72
24 0.68
25 0.59
26 0.5
27 0.42
28 0.34
29 0.26
30 0.15
31 0.11
32 0.05
33 0.04
34 0.03
35 0.03
36 0.02
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.07
46 0.1
47 0.1
48 0.1
49 0.1
50 0.12
51 0.13
52 0.13
53 0.11
54 0.15
55 0.17
56 0.18
57 0.18
58 0.18
59 0.17
60 0.18
61 0.22
62 0.22
63 0.25
64 0.3
65 0.38
66 0.43
67 0.49
68 0.53
69 0.53
70 0.59
71 0.63
72 0.6
73 0.59
74 0.61
75 0.63
76 0.61
77 0.61
78 0.55
79 0.57
80 0.63
81 0.58
82 0.6
83 0.59
84 0.66
85 0.68
86 0.71
87 0.71
88 0.66
89 0.67
90 0.6
91 0.57
92 0.51
93 0.48