Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DJ02

Protein Details
Accession A0A507DJ02    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108GKEKAATKKEEKKKEPEPEEBasic
NLS Segment(s)
PositionSequence
88-102PGKEKAATKKEEKKK
Subcellular Location(s) cyto 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006414  P:translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05831  Ribosomal_P1  
Amino Acid Sequences MSLSTAEAACVYAALILHDEDIEITSEKLASLIEAAGVEVESVWPVLFAKALKGKDVGEILSNVGAGGAAVAIAAAPAAAPAEAPGSPGKEKAATKKEEKKKEPEPEESDDDMGLGLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.06
4 0.07
5 0.07
6 0.07
7 0.06
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.06
17 0.05
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.08
37 0.13
38 0.13
39 0.14
40 0.15
41 0.15
42 0.16
43 0.16
44 0.14
45 0.09
46 0.09
47 0.09
48 0.08
49 0.07
50 0.05
51 0.05
52 0.04
53 0.03
54 0.02
55 0.02
56 0.02
57 0.01
58 0.01
59 0.01
60 0.01
61 0.01
62 0.01
63 0.01
64 0.01
65 0.02
66 0.02
67 0.02
68 0.02
69 0.04
70 0.04
71 0.06
72 0.07
73 0.1
74 0.11
75 0.12
76 0.13
77 0.17
78 0.2
79 0.28
80 0.36
81 0.39
82 0.47
83 0.57
84 0.66
85 0.71
86 0.75
87 0.75
88 0.77
89 0.82
90 0.79
91 0.78
92 0.74
93 0.7
94 0.7
95 0.64
96 0.55
97 0.44
98 0.37
99 0.28