Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507D883

Protein Details
Accession A0A507D883   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
53-72TSSRQKRRPYDERSSRPKSKBasic
NLS Segment(s)
Subcellular Location(s) cyto 5.5, cyto_nucl 10.5, mito 6, nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTSCLMKCESGWCLNPIIPLCLRCINKERNGSSLQAVMEHMLGNYMASYYEATSSRQKRRPYDERSSRPKSKGMLQQGVGKYNIRPISRQVDLSQDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.27
4 0.26
5 0.23
6 0.21
7 0.23
8 0.28
9 0.28
10 0.29
11 0.35
12 0.39
13 0.44
14 0.51
15 0.49
16 0.46
17 0.47
18 0.44
19 0.38
20 0.33
21 0.26
22 0.18
23 0.17
24 0.13
25 0.11
26 0.09
27 0.08
28 0.05
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.06
38 0.07
39 0.09
40 0.17
41 0.24
42 0.32
43 0.39
44 0.45
45 0.49
46 0.58
47 0.65
48 0.66
49 0.7
50 0.73
51 0.76
52 0.79
53 0.82
54 0.8
55 0.73
56 0.69
57 0.61
58 0.59
59 0.58
60 0.58
61 0.56
62 0.51
63 0.56
64 0.54
65 0.54
66 0.47
67 0.4
68 0.31
69 0.32
70 0.36
71 0.29
72 0.29
73 0.32
74 0.37
75 0.39
76 0.42
77 0.36