Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DJC1

Protein Details
Accession A0A507DJC1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-82LPMRPYTRSNSKNKKARLRKLTWRNMDVYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MPSTLGEGPRLYCFPRESEVFRGILRQSSAVAEWAASQEKKPVMYIGDLLNDPLPMRPYTRSNSKNKKARLRKLTWRNMDVYPDAAIVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.29
4 0.3
5 0.33
6 0.34
7 0.31
8 0.3
9 0.3
10 0.26
11 0.25
12 0.22
13 0.17
14 0.15
15 0.14
16 0.14
17 0.12
18 0.11
19 0.08
20 0.08
21 0.09
22 0.11
23 0.1
24 0.1
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.11
31 0.11
32 0.12
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.09
42 0.08
43 0.1
44 0.13
45 0.17
46 0.22
47 0.32
48 0.39
49 0.48
50 0.58
51 0.66
52 0.72
53 0.77
54 0.83
55 0.84
56 0.86
57 0.86
58 0.84
59 0.85
60 0.87
61 0.89
62 0.87
63 0.8
64 0.74
65 0.66
66 0.62
67 0.53
68 0.44
69 0.34