Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DS99

Protein Details
Accession A0A507DS99    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
59-79KVPIGKKSKQNCKTEQKPKIYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPRVSGCASIKGHLVAHHIQPSLRLLHRRSHYKSQAVSLPTHYSRQVIFQKKYNYFVYKVPIGKKSKQNCKTEQKPKIYTPKAIQRVGYQSACVTSLVSTINIHGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.25
4 0.28
5 0.27
6 0.25
7 0.26
8 0.26
9 0.26
10 0.27
11 0.29
12 0.27
13 0.34
14 0.41
15 0.49
16 0.53
17 0.58
18 0.61
19 0.61
20 0.6
21 0.56
22 0.54
23 0.48
24 0.42
25 0.35
26 0.33
27 0.28
28 0.28
29 0.25
30 0.21
31 0.19
32 0.24
33 0.3
34 0.32
35 0.33
36 0.37
37 0.44
38 0.45
39 0.49
40 0.46
41 0.4
42 0.34
43 0.34
44 0.32
45 0.29
46 0.31
47 0.3
48 0.35
49 0.37
50 0.41
51 0.48
52 0.54
53 0.6
54 0.65
55 0.69
56 0.7
57 0.75
58 0.8
59 0.81
60 0.81
61 0.79
62 0.77
63 0.77
64 0.79
65 0.73
66 0.69
67 0.66
68 0.67
69 0.66
70 0.63
71 0.57
72 0.51
73 0.53
74 0.52
75 0.45
76 0.36
77 0.29
78 0.27
79 0.27
80 0.22
81 0.16
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11